KEGG   Bordetella bronchiseptica RB50: BB0885Help
Entry
BB0885            CDS       T00141                                 

Gene name
pgm
Definition
phosphoglucomutase (EC:5.4.2.8)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
bbr  Bordetella bronchiseptica RB50
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bbr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BB0885 (pgm)
   00030 Pentose phosphate pathway
    BB0885 (pgm)
   00051 Fructose and mannose metabolism
    BB0885 (pgm)
   00052 Galactose metabolism
    BB0885 (pgm)
   00500 Starch and sucrose metabolism
    BB0885 (pgm)
   00520 Amino sugar and nucleotide sugar metabolism
    BB0885 (pgm)
  Nucleotide metabolism
   00230 Purine metabolism
    BB0885 (pgm)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BB0885 (pgm)
Enzymes [BR:bbr01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     BB0885 (pgm)
    5.4.2.8  phosphomannomutase
     BB0885 (pgm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
complement(942170..943552)
Genome map
AA seq 460 aa AA seqDB search
MAHPFPASVYKAYDIRGSVPDQLDPVFARALGRALAASARAQGIGALVVGRDGRLSSPDL
AGALQEGIMEGGVDTLDIGQVPTPLVYFAAHTQGTGSGVAVTGSHNPPQYNGFKMMMGGQ
ALYGPAVQALRPAMLAPAAAPGTWGERRQLDVVPAYIERIVSDVKLARPMKIAVDCGNGV
AGALAPQLFRALGCEVDELYCEVDGTFPNHHPDPAEPRNLQDLIAHVTSTDCELGLAFDG
DGDRLGVVTKSGQIIWPDRQLILFARDVLARCPGATIIYDVKCSRHVGVAIEQSGGVPLM
WQTGHSLVKAKLAETGAPLAGEMSGHIFFKERWYGFDDGLYTGARLLEIVSRETDASRPL
EALPQALSTPELKLEMAEGEPHALIAALQQQGEFASASRLVTIDGVRAEYPDGFGLARAS
NTTPVVVLRFEAETEPGLARIQQEFRQQLLRLAPQAKLPF
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
gtggcgcacccctttcccgcatcggtctacaaggcgtacgacatccgtggctcggttccc
gaccagctcgacccggtattcgcccgggcgctgggccgtgccctggccgccagcgcccgc
gcgcagggcatcggcgccctggtggtcggccgcgacggccgcctgagcagccccgacctg
gccggcgcgctgcaggaaggcatcatggaaggcggtgtggataccctggatatcggccag
gtgcccacgccgctggtctatttcgcggcgcacacccagggcacgggctcgggcgtggcg
gtcaccggcagccacaacccgccgcagtacaacggcttcaagatgatgatgggcggccag
gccctgtacggcccggccgtgcaggcgctgcgcccggccatgctggcgccggctgcggcg
ccgggcacctggggcgaacgccgccagctcgatgtcgtccccgcctatatcgagcgcatc
gtgtcggacgtgaagctggcgcgccccatgaagatcgccgtcgactgcggcaatggcgtg
gccggcgccctggcgccgcaattgttccgcgcgctgggctgcgaagtggacgaactctat
tgcgaggtcgacggcacgtttcccaaccaccatcccgacccggccgaaccgcgcaacctg
caggacctgatcgcccatgtcaccagcaccgactgcgagctgggcctggccttcgacggc
gacggcgaccgcctgggcgtggtgaccaagtccggccagatcatctggcccgaccgccag
ctgatcctgttcgcccgcgacgtgctggcccgctgccccggcgcgaccatcatctatgac
gtcaagtgcagccggcacgtgggcgtggccatcgagcaaagcggcggcgtgccgctgatg
tggcagaccggccattcgctggtgaaggccaagctggccgagaccggcgcgccgctggcc
ggcgagatgagcggccatatcttcttcaaggagcgctggtacggcttcgacgacggcctg
tacaccggcgcccgcctgctggaaatcgtctcccgcgaaaccgatgcgtcgcgcccgctg
gaggccctgccgcaggcgctgtcgacccccgagctcaagctggaaatggccgagggcgag
ccgcatgcgctgatcgccgccctgcagcagcagggcgagttcgccagcgccagccggctg
gttacgatagacggcgtgcgcgcggaatacccggacggcttcgggctggcgcgcgcctcc
aataccacccccgtcgtcgtgctgcgcttcgaggcggagaccgagccgggcctggcccgc
atccagcaggaattccgccagcagctgctgcggctggctccgcaagccaaactgcccttc
tga

DBGET integrated database retrieval system