KEGG   Bordetella bronchiseptica RB50: BB0885Help
Entry
BB0885            CDS       T00141                                 

Gene name
pgm
Definition
(GenBank) phosphoglucomutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
bbr  Bordetella bronchiseptica RB50
Pathway
bbr00010  Glycolysis / Gluconeogenesis
bbr00030  Pentose phosphate pathway
bbr00051  Fructose and mannose metabolism
bbr00052  Galactose metabolism
bbr00230  Purine metabolism
bbr00500  Starch and sucrose metabolism
bbr00520  Amino sugar and nucleotide sugar metabolism
bbr00521  Streptomycin biosynthesis
bbr01100  Metabolic pathways
bbr01110  Biosynthesis of secondary metabolites
bbr01120  Microbial metabolism in diverse environments
bbr01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bbr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BB0885 (pgm)
   00030 Pentose phosphate pathway
    BB0885 (pgm)
   00051 Fructose and mannose metabolism
    BB0885 (pgm)
   00052 Galactose metabolism
    BB0885 (pgm)
   00500 Starch and sucrose metabolism
    BB0885 (pgm)
   00520 Amino sugar and nucleotide sugar metabolism
    BB0885 (pgm)
  Nucleotide metabolism
   00230 Purine metabolism
    BB0885 (pgm)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BB0885 (pgm)
Enzymes [BR:bbr01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     BB0885 (pgm)
    5.4.2.8  phosphomannomutase
     BB0885 (pgm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: CAE31384
GeneDB: BB0885
UniProt: A0A0H3LN88
Position
complement(942170..943552)
Genome map
AA seq 460 aa AA seqDB search
MAHPFPASVYKAYDIRGSVPDQLDPVFARALGRALAASARAQGIGALVVGRDGRLSSPDL
AGALQEGIMEGGVDTLDIGQVPTPLVYFAAHTQGTGSGVAVTGSHNPPQYNGFKMMMGGQ
ALYGPAVQALRPAMLAPAAAPGTWGERRQLDVVPAYIERIVSDVKLARPMKIAVDCGNGV
AGALAPQLFRALGCEVDELYCEVDGTFPNHHPDPAEPRNLQDLIAHVTSTDCELGLAFDG
DGDRLGVVTKSGQIIWPDRQLILFARDVLARCPGATIIYDVKCSRHVGVAIEQSGGVPLM
WQTGHSLVKAKLAETGAPLAGEMSGHIFFKERWYGFDDGLYTGARLLEIVSRETDASRPL
EALPQALSTPELKLEMAEGEPHALIAALQQQGEFASASRLVTIDGVRAEYPDGFGLARAS
NTTPVVVLRFEAETEPGLARIQQEFRQQLLRLAPQAKLPF
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
gtggcgcacccctttcccgcatcggtctacaaggcgtacgacatccgtggctcggttccc
gaccagctcgacccggtattcgcccgggcgctgggccgtgccctggccgccagcgcccgc
gcgcagggcatcggcgccctggtggtcggccgcgacggccgcctgagcagccccgacctg
gccggcgcgctgcaggaaggcatcatggaaggcggtgtggataccctggatatcggccag
gtgcccacgccgctggtctatttcgcggcgcacacccagggcacgggctcgggcgtggcg
gtcaccggcagccacaacccgccgcagtacaacggcttcaagatgatgatgggcggccag
gccctgtacggcccggccgtgcaggcgctgcgcccggccatgctggcgccggctgcggcg
ccgggcacctggggcgaacgccgccagctcgatgtcgtccccgcctatatcgagcgcatc
gtgtcggacgtgaagctggcgcgccccatgaagatcgccgtcgactgcggcaatggcgtg
gccggcgccctggcgccgcaattgttccgcgcgctgggctgcgaagtggacgaactctat
tgcgaggtcgacggcacgtttcccaaccaccatcccgacccggccgaaccgcgcaacctg
caggacctgatcgcccatgtcaccagcaccgactgcgagctgggcctggccttcgacggc
gacggcgaccgcctgggcgtggtgaccaagtccggccagatcatctggcccgaccgccag
ctgatcctgttcgcccgcgacgtgctggcccgctgccccggcgcgaccatcatctatgac
gtcaagtgcagccggcacgtgggcgtggccatcgagcaaagcggcggcgtgccgctgatg
tggcagaccggccattcgctggtgaaggccaagctggccgagaccggcgcgccgctggcc
ggcgagatgagcggccatatcttcttcaaggagcgctggtacggcttcgacgacggcctg
tacaccggcgcccgcctgctggaaatcgtctcccgcgaaaccgatgcgtcgcgcccgctg
gaggccctgccgcaggcgctgtcgacccccgagctcaagctggaaatggccgagggcgag
ccgcatgcgctgatcgccgccctgcagcagcagggcgagttcgccagcgccagccggctg
gttacgatagacggcgtgcgcgcggaatacccggacggcttcgggctggcgcgcgcctcc
aataccacccccgtcgtcgtgctgcgcttcgaggcggagaccgagccgggcctggcccgc
atccagcaggaattccgccagcagctgctgcggctggctccgcaagccaaactgcccttc
tga

DBGET integrated database retrieval system