KEGG   Bordetella bronchiseptica RB50: BB0913Help
Entry
BB0913            CDS       T00141                                 

Definition
type III restriction enzyme (EC:3.1.21.5)
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
bbr  Bordetella bronchiseptica RB50
Brite
Enzymes [BR:bbr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.5  type III site-specific deoxyribonuclease
     BB0913
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
977922..981008
Genome map
AA seq 1028 aa AA seqDB search
MKLKFKTQAYQTAAVQAVVDCFKGQVPHHGGIRYRLDPGSQKVAPESPQAALALEAASPE
AAAEKEAAFRNADFTLSETALLDNIQAVQRGQNLPLSDTLVKTKVAKVNLDIEMETGTGK
TYCYIKTIFELNKLYGWSKFIIVVPSVAIREGVAKSLEITAEHFLETYRKKARFFIYNSK
QLHHLESFSSDAGINVMVINVQAFASRGAENRRIYDVLDDFQSRRPIDVISANRPIMILD
EPQKMEGAATLKSLEAFKALMVLRYSATHKTTHNKIHRLDALDAYNQKLVKKIAVRGIAV
KGLAGTAGYLYLQSIEISSKKPPEARIELEHKLANGDIKRVVRKLGKGDNLFDLSGGLDQ
YRNYVVTDINANTDTLSFTNGVELTVGDATGDVTEAALRRIQIREAIKAHFDKEQALFQQ
GVKVLTLFFIDEVAKYRDYTQADEKGEYARIFEEEYTQYLNEMLDLDETAYVKYLKGIPV
DKTHSGYFSIDKKTKRLADPTVAARGENAGLSDDVDAYDLILKDKERLLSLAEPVRFIFS
HSALREGWDNPNVFVICALKHSDNTISRRQEVGRGLRLSVNQTGDRMDHPATVHEVNVLT
VVASESYKDFVAALQKDISDSLSERPRVANEEYFTGKVLKTATGDVPVTPQLAKQIYRYL
VKNDYTDDSDRIAGAYHDAKKAGTLADLPDELKPHAAQVYQLIDSVFSASQLPDIGDDRK
PKKNPLNANFDKQEFKALWNRINRKAAYSVDFDSDELVQKAVKEMDAALRVTPLQYTIQA
GEQIDQVTGEALKRGDGFKVAETQTEYNKQSIHSAVKYDLIGKLAEGTQLTRRTVAEILK
GINLAVFAQFKTNPESFVAEATRLINEQKATVIIEHLAYDPVEDKFDLDIFTAGQTKQDF
SKADDKLQRHIYDYVLTDSKVEREFVKELDTANEVVVYAKLPRGFLIPTPVGDYNPDWAI
SFKEGAVKHIYFVAETKGSMSSMDLREIEKTKIKCARKFFDEMNRRYAPENVKYDVVDSF
GKLMEVVK
NT seq 3087 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgaaattcaagacgcaggcctaccagactgccgccgtacaggcggtggtggac
tgcttcaaggggcaggttccacatcacggcggcattcgctaccggctcgatcccggcagc
cagaaagtagccccagagagcccgcaagcggcgctcgcgctggaggccgcttcgcctgaa
gctgcagcggaaaaggaagccgcgtttcgcaacgccgacttcacgctgtcggaaactgcg
ctgctggacaacatccaggccgtccagcgggggcagaacctgccgttgtcggatacgctg
gtcaagaccaaggttgccaaggtcaatctcgacatcgagatggagaccggtacgggcaag
acctactgctacatcaagaccatcttcgagctgaacaagctgtacggctggagcaagttc
atcattgtcgtgcccagcgtcgccatccgtgagggcgtggccaagtcgttggagatcacg
gccgagcacttcctggaaacctaccgcaagaaagcgcgtttcttcatctacaactccaag
caactgcaccacctggagagcttctcgtcggacgcgggcatcaacgtgatggtgatcaac
gtgcaggctttcgcctcgcgcggggcggaaaaccgccgcatctacgacgtgctggacgac
ttccagtcccgcaggcccatcgacgtgatcagcgccaaccgtccgatcatgattctggat
gagccgcagaagatggaaggtgcggcgacgctgaaatcgctggaggcattcaaggcgctg
atggtgctgcgctactcggccactcacaagaccacccacaacaagattcaccgcctcgat
gcgctggacgcctacaaccagaagctggtgaagaaaatcgccgtgcgcggcatcgcggtg
aaggggctggcggggacggctggctatctgtacctgcaatccattgagatttcgagcaag
aagccgcccgaggcgcgcatcgagttggagcacaagctcgccaatggtgacatcaagcgc
gtggtgcgcaagctcggcaagggcgacaacctgttcgacctgtcgggcgggttggatcag
taccgcaactacgtggtgacggatatcaacgccaacaccgacaccctgagctttactaat
ggcgtggagctgacggttggcgacgccaccggcgatgtgaccgaggcggcgctgcgtcgc
atccagattcgtgaggccatcaaggcgcacttcgacaaggaacaggcgttgttccaacaa
ggcgtgaaggtgctgaccctgttcttcatcgacgaagtggccaagtaccgcgactacacg
caggcggacgaaaagggtgaatacgcccgcatctttgaagaggaatacacgcagtacctg
aacgagatgctcgatctggacgagacggcctacgtcaagtacctgaagggcattccggtg
gacaagacccatagcggctacttttccatcgacaagaaaaccaagcggttggctgacccg
acggttgccgcgcgcggcgagaacgctgggctttcagatgacgtggatgcctacgatctg
atcttgaaggacaaggagcgcttgctgtcgctcgccgagccggtgcgcttcattttttcg
cactcggccctgcgcgaaggctgggacaacccgaacgtgttcgtcatctgcgcgctcaaa
cacagcgacaacaccatctcccgacgtcaggaggtggggcgtggcttgcggctgtccgtc
aaccagacaggcgaccggatggatcacccggctaccgttcacgaagtgaacgtgctgacc
gtggtcgccagcgagagctacaaagacttcgttgccgcgctgcagaaggacatcagcgat
tcgctttctgaacgtccgcgcgtggcaaacgaggaatacttcaccggcaaagtgctgaaa
acggcgaccggagatgtgccggttacaccgcaactggcgaagcaaatctaccgttatttg
gtcaagaacgactacacagacgattcagatcggattgcgggtgcgtatcacgatgccaag
aaggccggaacgctggccgacctgccagacgaattgaagccgcacgccgcgcaggtgtac
cagctgatcgacagtgtgttcagcgccagccaattgcccgacattggcgacgaccgcaaa
cccaagaagaacccgctcaacgccaatttcgacaagcaggagttcaaggcgctgtggaac
cgcatcaaccgcaaggcggcctacagtgtcgatttcgactcggacgagctggtgcaaaag
gcggtcaaggagatggacgcggctctgcgcgtgaccccgttgcaatacaccatccaggca
ggcgaacagatcgaccaggtgactggcgaggcgctaaagcgtggagacggattcaaggtt
gccgagacacagaccgaatacaacaagcagtcgattcattcagcggtcaagtacgacttg
atcggcaagctggcagaaggtactcaactgactcgccgcacggtggcggaaatcctcaag
ggtattaacctcgcggtttttgcacagttcaagacaaaccctgaaagtttcgtcgccgag
gccacgcgactcatcaacgagcagaaggccacggtcatcatcgaacacctggcctacgat
cccgtcgaggacaagttcgacctcgacatcttcactgccgggcagaccaagcaggacttc
agcaaggccgatgacaagctccagcgacacatctacgactatgtgctgacggattcgaag
gtggaacgggagttcgtgaaagagctggacacagcaaatgaagtggtggtctatgccaag
ttgccacgcggcttccttattcccacgcccgtgggtgactacaacccggactgggcgatc
agcttcaaggaaggcgctgtcaagcacatctacttcgtggcggaaaccaagggctccatg
tcctcgatggacctgcgtgagatcgagaagaccaagatcaagtgcgcccgcaagttcttc
gatgagatgaaccgccgctacgccccagagaacgttaagtacgacgtggtggacagtttc
ggcaagctgatggaggtggtgaagtag

DBGET integrated database retrieval system