KEGG   Bordetella bronchiseptica RB50: BB1153Help
Entry
BB1153            CDS       T00141                                 

Definition
acetyl-CoA synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bbr  Bordetella bronchiseptica RB50
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:bbr01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bbr00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:bbr00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:bbr00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:bbr00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
1235764..1237395
Genome map
AA seq 543 aa AA seqDB search
MTPEYTAALERFDWRAVRGALGWGEAHAVDLAHAIIDRHRASGRTALVFIDQQGRESRHS
YAELAEQSDRAANLLARLGVRPGDRVAGLLPRGPEILVAMLAAIKIGAIYVPIFTGFKRD
AIEYRLGHSGARVVFTHAALRGQLPAVLPGQARCVTVAAGAADTAAGDIDFAAALREAEP
RFAAQPREREDIAALIYTSGSTGRPKGGAIAVNFLAAVWPYLTYGADMRADDVVWPTGDP
GWGYGFVCYLGALAMGATIVSLAANPTPEVCLDVLARQRVSNFATTPTLLRGVMALGMDA
VRARPNAVRAISSCGEPLNGEVVEFFQQAWGRTPMDHFGATEYGLPVGNFNAVAVPAKAG
SMGLPFPGYEIAVLDDAGQPLAGAHASGWLAKRRSADRLYWSHYWDDAGATAELERGEWI
VTGDLAHRDAEGYYWFDGRAGDMIKSAGYRIGPFEVESALLAHGAVAEAAVVGVPDALRG
ELVKAYIVLLPGHAASPRLAEEIQLFVKTHCGAHLYPRIVEFVPDLPKTDTGKIQRFALR
QRA
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atgactcccgaatacaccgccgcgcttgaacggttcgactggcgcgcggtacgcggcgcg
ctgggctggggcgaagcccacgccgtggacctggcgcacgccatcatcgaccgccaccgc
gccagcgggcgcacggcgctggtcttcatcgaccagcagggccgcgagtcgcgccactcg
tacgcggaactggccgagcaaagcgaccgcgccgccaacctgctggcccggctgggcgtg
cggccgggcgaccgcgtggccggcttgctgccgcgcggcccggaaatcctggttgcgatg
ctggcggccatcaagatcggcgcgatctacgtacccatcttcaccggtttcaagcgcgac
gccatcgaataccgcctgggccacagcggcgcgcgcgtggtcttcacccacgcggcgctg
cgcggccagttgccggccgtgctgccgggccaggcgcgctgcgtgaccgtggcggcaggc
gccgccgacacggccgcaggcgatatcgatttcgccgcggcgctgcgcgaggccgagccg
cgcttcgcggcgcagccgcgcgagcgcgaggacatcgccgcgctgatctatacctcgggc
tcgaccggccggcccaagggcggcgccatcgcggtcaacttcctggccgcggtctggccc
tacctgacctacggcgcggacatgcgcgccgacgacgtggtctggcccaccggcgatccg
ggctggggatacggcttcgtgtgctacctgggcgcgctggccatgggggccaccattgtg
tcgctggcggccaatccgacgcccgaggtgtgcctggatgtgctggcgcgccagcgggtc
agcaacttcgcgaccacgcctaccctgttgcgcggcgtgatggcgctgggcatggacgcc
gtgcgcgcgcggcccaacgcggtgcgcgccatatccagctgcggcgagccgctcaacggc
gaggtggtggaattcttccagcaggcctggggccgcacgccgatggatcatttcggcgcc
accgaatacggcctgccggtgggcaacttcaatgcggtcgcggtgccggccaaggccggc
tccatgggcctgccgtttcccggctacgagatcgccgtgctggacgacgccggccagccg
ctggccggcgcgcacgccagcggctggctggccaagcgccgcagcgccgaccggctgtat
tggagccattactgggacgacgccggcgccaccgccgaactggagcgcggcgagtggatc
gtcaccggcgacctggcgcatcgcgacgccgagggctactactggttcgacggccgcgcc
ggcgacatgatcaagagcgcgggctatcgcatcggcccgttcgaagtcgagagcgccctg
ctggcccacggggccgtggctgaggcggccgtggtcggcgtgcccgacgccctgcgcggc
gaactggtcaaggcctacatcgtgctgctgcccggccatgcggccagcccgcggctggcc
gaggagatccagctgttcgtcaagacccactgcggcgcgcacctgtacccgcgcatcgtc
gagttcgtgcccgacctgcccaagaccgacaccggcaagatccagcgcttcgcgttgcgc
cagcgcgcctag

DBGET integrated database retrieval system