KEGG   Bordetella bronchiseptica RB50: BB1440Help
Entry
BB1440            CDS       T00141                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
bbr  Bordetella bronchiseptica RB50
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:bbr03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
1537026..1537634
Genome map
AA seq 202 aa AA seqDB search
MDPQLPEPEPLIALIEALRRLPGVGVRSARRMAYHLLQHDLQGADMLGRALSGAVQHLRH
CARCNSFTEDEVCATCANPKRDPGLLCIVETPADQNMIESSHGYRGLYYVLMGRIAPLEG
VGPRELDFQRVIERACDGVVQEVILATNFTAEGETTAHFLGDALSERGLKVTRLARGVPA
GSELEYVDAGTIAWALMERRST
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atggatccccaactccccgaacccgaaccgctgatcgccctgatcgaggcgttgcgccgc
ctgcctggcgtgggcgtgcgctcggcccgccgcatggcctatcacctgctgcagcacgac
ctgcagggggccgacatgctgggccgcgcgctttccggcgccgtgcagcacctgcgccat
tgcgcgcgctgcaacagctttaccgaagacgaggtctgcgcgacctgtgccaatcccaag
cgcgatcccggcctgctgtgcatcgtcgagacgccggcggaccagaacatgatcgagtcc
agccacggctaccgcgggctgtactacgtgctgatgggacgcatcgcgccgctggaaggg
gtgggaccgcgcgagctcgacttccagcgcgtcatcgagcgcgcctgcgacggcgtggtc
caggaagtcatcctggccaccaatttcaccgccgagggcgagacgacggcccacttcctg
ggcgatgccctgagcgagcgcggcctgaaagtcacccggctggcgcgcggcgtgccggcc
ggcagcgagctcgagtatgtcgatgccggcaccattgcctgggccttgatggagcgccgt
tcgacctag

DBGET integrated database retrieval system