KEGG   Bordetella bronchiseptica RB50: BB1440Help
Entry
BB1440            CDS       T00141                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
bbr  Bordetella bronchiseptica RB50
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bbr00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BB1440 (recR)
DNA repair and recombination proteins [BR:bbr03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      BB1440 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
1537026..1537634
Genome map
AA seq 202 aa AA seqDB search
MDPQLPEPEPLIALIEALRRLPGVGVRSARRMAYHLLQHDLQGADMLGRALSGAVQHLRH
CARCNSFTEDEVCATCANPKRDPGLLCIVETPADQNMIESSHGYRGLYYVLMGRIAPLEG
VGPRELDFQRVIERACDGVVQEVILATNFTAEGETTAHFLGDALSERGLKVTRLARGVPA
GSELEYVDAGTIAWALMERRST
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atggatccccaactccccgaacccgaaccgctgatcgccctgatcgaggcgttgcgccgc
ctgcctggcgtgggcgtgcgctcggcccgccgcatggcctatcacctgctgcagcacgac
ctgcagggggccgacatgctgggccgcgcgctttccggcgccgtgcagcacctgcgccat
tgcgcgcgctgcaacagctttaccgaagacgaggtctgcgcgacctgtgccaatcccaag
cgcgatcccggcctgctgtgcatcgtcgagacgccggcggaccagaacatgatcgagtcc
agccacggctaccgcgggctgtactacgtgctgatgggacgcatcgcgccgctggaaggg
gtgggaccgcgcgagctcgacttccagcgcgtcatcgagcgcgcctgcgacggcgtggtc
caggaagtcatcctggccaccaatttcaccgccgagggcgagacgacggcccacttcctg
ggcgatgccctgagcgagcgcggcctgaaagtcacccggctggcgcgcggcgtgccggcc
ggcagcgagctcgagtatgtcgatgccggcaccattgcctgggccttgatggagcgccgt
tcgacctag

DBGET integrated database retrieval system