KEGG   Bordetella bronchiseptica RB50: BB1794Help
Entry
BB1794            CDS       T00141                                 

Definition
(GenBank) Putative enoyl-CoA hydratasee
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
bbr  Bordetella bronchiseptica RB50
Pathway
bbr00071  Fatty acid degradation
bbr00280  Valine, leucine and isoleucine degradation
bbr00281  Geraniol degradation
bbr00310  Lysine degradation
bbr00362  Benzoate degradation
bbr00380  Tryptophan metabolism
bbr00410  beta-Alanine metabolism
bbr00640  Propanoate metabolism
bbr00650  Butanoate metabolism
bbr00903  Limonene and pinene degradation
bbr00930  Caprolactam degradation
bbr01040  Biosynthesis of unsaturated fatty acids
bbr01100  Metabolic pathways
bbr01110  Biosynthesis of secondary metabolites
bbr01120  Microbial metabolism in diverse environments
bbr01130  Biosynthesis of antibiotics
bbr01200  Carbon metabolism
bbr01212  Fatty acid metabolism
Module
bbr_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:bbr00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BB1794
   00650 Butanoate metabolism
    BB1794
  Lipid metabolism
   00071 Fatty acid degradation
    BB1794
   01040 Biosynthesis of unsaturated fatty acids
    BB1794
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BB1794
   00310 Lysine degradation
    BB1794
   00380 Tryptophan metabolism
    BB1794
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BB1794
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BB1794
   00281 Geraniol degradation
    BB1794
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BB1794
   00930 Caprolactam degradation
    BB1794
Enzymes [BR:bbr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     BB1794
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BB1794
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     BB1794
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 ECH_2 3HCDH NAD_binding_2 AlaDh_PNT_C ApbA UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-ProteinID: CAE32291
GeneDB: BB1794
UniProt: A0A0H3LQI4
Position
complement(1889090..1891033)
Genome map
AA seq 647 aa AA seqDB search
MNTPDLAYTHWRLHREADGLAWLALARADAAANSLSAEVMAELAAVLDALQAQPPNGLVI
LSGKENGFIVGADINEFGALQTPQQARELVARGWQLFNRLAATPYPTLALIRGHCLGGGL
ELALACRYRIAADDADTALGLPEAMLGIFPGWGGMRRLPALIGAPAALDMMLTGRRVDAR
RAAALGLVDARVPPRLLQAAARATVLSGRAPRRARGLPAWLNRWPLKALAARRARQSVAA
KDPQGHYPAPRAIIDIWARHGGNALHAPDLIDGILASDTARQLLRVFRLQERLKGYGKAA
VDAPVRRVHVVGAGVMGGDIAAWCAYRGLTVTLQDQDMARIAPALARAGAFFARKLKDRR
AARAAFDRLVPDPQGDGVAQADLVIEAISENAQAKQALYRQLEPRLKPGALLATNTSSLS
LAGLAQVLDQPQRLVGIHFFNPVARMPLVEVVLAADGDPRALARACAFVGRIGKLPLPVR
DAPGFLVNAVLAPYMLEAMRCVDEGMAPAAIDAAMAAFGMPMGPLELADTVGLDIAAAAG
AQLTGEQAPPRCLAERLARKELGRKSGRGFYAWRDGKAVKPAARGVPPGLVDRLLQPLID
SARERVAAGVVADADLADAGAIFGTGFAPYTGGPLQYASQREAVQRP
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atgaacacgcccgacctggcctacacccactggcgcctgcaccgtgaagccgacggcctg
gcatggctggcgctggcgcgcgccgacgccgccgcgaactcgctgtcggccgaggtcatg
gccgaactcgccgcggtgctcgacgccctgcaggcccagccgcccaacggactggtcatt
ctgtcgggcaaggagaacggcttcatcgtcggcgccgacatcaacgaattcggcgcgctg
cagacgccgcagcaggcgcgcgaactggtcgcgcgcggctggcagctgttcaaccggctg
gcggcgacgccgtaccccacgctggcgctgatacgcggccactgcctgggcggcggcctg
gaactggcgctggcctgccgctaccgcatcgccgccgacgacgccgacaccgcgctgggg
ctgccggaagccatgctgggcattttccccggctggggcggcatgcggcgcctgccggcg
ctgatcggcgcgccggccgcgctggacatgatgctgaccggacgccgggtcgacgcgcgc
cgcgccgcggcgctgggcctggtcgacgcgcgcgtgccgccgcggctgctgcaggccgcc
gcccgcgccaccgtgctgtcgggccgagcgccgcgccgcgcgcgcggcctgccggcctgg
ctgaaccgctggccgctcaaggcgctggcggcgcgccgcgcgcgccagagcgtggccgcc
aaggatccgcagggccactaccccgccccgcgcgccatcatcgacatctgggcgcgccac
ggcggcaacgccctgcatgcgcccgacctgatagacggcatcctggcttcggacacggcg
cgccagctgctacgcgtgttccgcctgcaggaacggctcaagggctacggcaaggccgcc
gtcgacgcgcccgtgcggcgcgtgcacgtggtgggcgccggcgtcatgggcggcgatatc
gccgcctggtgcgcctaccgcgggttgaccgtcacgctgcaagaccaggacatggcgcgc
atcgcgccggcgctggcgcgcgccggcgccttcttcgcccgcaagctgaaggaccggcgc
gccgcgcgcgccgccttcgaccgcctggttcccgacccccagggcgatggcgtggcgcaa
gccgacctggtcatcgaggccatcagcgagaacgcccaggccaagcaggccctctaccgc
cagctcgaaccgcgcctgaaaccgggcgccctgctggccaccaatacctccagcctgtcg
ctggccgggctggcccaggtcctcgaccagccgcagcggctggtcggcatccatttcttc
aacccggtggcgcgcatgccgctggtcgaagtcgtgctcgccgccgacggcgatccgcgc
gcgctggcgcgggcctgcgccttcgtcggccgcatcggcaagctgccgctgcccgtgcgc
gacgcgccgggtttcctggtcaatgcggtgctggcgccctacatgctggaagcgatgcgc
tgcgtcgacgagggcatggcgccggcggccatcgacgccgccatggccgccttcggcatg
ccgatggggccgctcgagctggccgacaccgtcgggctggacatcgcggcggccgccggc
gcccagctcaccggcgagcaagcgccgccgcgctgcctggccgaacgcctggcgcgcaag
gaactgggccgcaagagcggccgcggcttttatgcctggcgcgacggcaaggcggtcaag
ccggccgcgcgcggcgtgccgccagggctggtcgaccgcctgctccagcccctgatcgac
agcgcccgcgagcgcgtggccgccggcgtggtggccgatgcggacctggccgacgcgggc
gcgattttcggcacgggctttgccccctacacgggcggcccgctgcaatacgcaagtcaa
cgagaagccgtccagcggccttag

DBGET integrated database retrieval system