KEGG   Bordetella bronchiseptica RB50: BB1927Help
Entry
BB1927            CDS       T00141                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
bbr  Bordetella bronchiseptica RB50
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bbr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BB1927 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BB1927 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BB1927 (thrC)
Enzymes [BR:bbr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BB1927 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
2048655..2050061
Genome map
AA seq 468 aa AA seqDB search
MKYISTRGGMAPQSFSDILLEGLAPDGGLAIPEQLPQVDAATLESWRGLSYADLAFEVLS
LFATDIPAEDLRGLTRAAYRQGVFKSEDIVPVRELGQGLQLLGLSEGPTLAFKDMAMQFL
GQVFEYVLTRRGTTLNIVGATSGDTGSAAEYALRGKQGVAVFMLSPHGRMSAFQRAQMYS
LQDENIHNIAVRGVFDQAQDIVKQLAGDLAFKTRYRLGAVNSINWARIAAQVVYYFHGWL
RAAPKGGEVSFAVPSGNFGNILSGHIARGMGVPIRRLVLATNENNVLEEFFRTGVYRPRG
PEHTYATSSPSMDISRASNFERFVFDLVGRDPGRVASLWADLARDGSFDLSALKPQFETR
YGFVAGASSHADRLQTIRNTFDETGVLVDPHTADGIKVARQFVEPGVPMLVLETALPAKF
AETIEAALGRTVPPPADLADLESLPQRVTLMDCDAQAVRAFIEAHAKV
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgaagtacatctcgacccgcggcggcatggccccgcagagtttctccgacatcctgctc
gaaggcctggcgcccgacggcgggctggccatccccgagcagctgccgcaagtcgacgcg
gccacgctggagtcctggcgcgggctctcgtacgccgacctggccttcgaagtgctgtcg
ctgttcgccaccgacatcccggccgaggacctgcgcgggctgacgcgcgcagcctaccgg
cagggcgtgttcaagagcgaagacatcgtcccggtgcgcgagctggggcaggggctgcag
ctgctgggcctgtccgaggggcccacgctggccttcaaggacatggcgatgcagtttctc
ggccaggtcttcgagtacgtcctgacgcggcgcggcaccacgctgaacatcgtcggcgcc
acctccggcgataccgggtcggcggccgagtacgcgctgcgcggcaagcagggcgtggcc
gtgttcatgctgtcgccgcacggccgcatgagcgcattccagcgcgcccagatgtactcg
ctgcaggatgagaacatccacaatatcgcggtgcggggcgtgttcgaccaggcgcaggac
atcgtcaagcagctggccggcgacctggcgttcaagacgcgctatcgcctgggcgcggtc
aactcgatcaactgggcgcgcatcgccgcccaggtggtgtactacttccacggctggctg
cgtgccgcgcccaagggtggcgaggtgtcgttcgcggtgccttcgggcaacttcggcaac
atcctgtccgggcacatcgcgcgcggcatgggcgtgccgatccgccgcctggtgctggcc
accaacgagaacaacgttctcgaggagttcttccgcaccggcgtttaccgcccgcgcggt
cccgagcacacctacgccacctccagcccgtcgatggacatctcgcgcgcctcgaacttc
gagcgcttcgtgttcgacctggtcgggcgcgaccccggccgcgtggcgtcgctgtgggcc
gacctggcgcgcgacggcagcttcgacctgtcggcgctcaagccgcagttcgaaacccgc
tacgggttcgtggccggcgccagctcgcacgccgaccgcctgcagaccatacgcaatacc
ttcgacgaaaccggcgtgctggtcgacccgcacacggccgatggcatcaaggtggcgcgc
cagttcgtcgagccgggcgtgcccatgctggtgctcgagacggccctgccggccaagttc
gcggaaaccatcgaggcggcgctcgggcgcaccgtgccgccgccggctgacctggccgac
ctcgaatcgctgccccagcgcgtgacgctcatggactgcgacgcgcaggcggtgcgggcc
ttcatcgaggcccacgccaaagtgtaa

DBGET integrated database retrieval system