KEGG   Bordetella bronchiseptica RB50: BB2060Help
Entry
BB2060            CDS       T00141                                 

Gene name
pyrB
Definition
(GenBank) aspartate transcarbamoylase (EC:2.1.3.2)
  KO
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
bbr  Bordetella bronchiseptica RB50
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bbr00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    BB2060 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BB2060 (pyrB)
Enzymes [BR:bbr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     BB2060 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
GeneDB: 
UniProt: 
Position
2204039..2205376
Genome map
AA seq 445 aa AA seqDB search
MRIAYISYSSLGPPMSISQQAFLRDAMRRLNLTRDVFAGRIGVKRRALDTWLLPEGSQEF
RAMPEVVERFVSEIVQNRDLLEKYTQSGQVGPLRDRIAVEGRHQLLSVDQFTRESVEDLF
RVADMMQPIARRQKVSRVLEGAVLGNLFFEASTRTRVSFGAAFCRLGGSVCDTTGFTFSS
MAKGESIYDTSRVMSGYVDAMVIRHPEQGSVAEFAEATNIPVVNGGDGPGEHPSQALLDL
YTILTEFSRLGKLLDGAHIAMVGDLKYGRTVHSLIKLLALYKGVKFTLISPQGLEMPGYI
VEQASRNGNVIEQKSTLAEGLAGADVIYATRVQKERFANEEAGEGYTADFQVSRAIIDAY
CGPDTIVMHPLPRDSRPGSNDLSTDLNHDPRLAIFRQTDNGIPIRMAIFAVLLGVEGLVQ
HSMRDVTWQHPSHIGPDDSVFHGLD
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgcgcattgcgtatatttcgtattcctccctggggccgcccatgtccatctcccaacaa
gcctttctgcgcgacgcgatgcgtcgtctcaacctgacgcgcgacgtgttcgccggtcgc
atcggcgtgaagcgccgcgcgctggatacatggctgctgcccgaagggtcgcaggagttt
cgcgcgatgcccgaagtggtggagcgcttcgtcagtgaaatcgtgcagaaccgcgacttg
ctggagaaatatacgcagagcgggcaggtaggccccttgcgcgaccgcatcgccgtcgaa
gggcgccatcagctgctgtcggtcgatcaattcacccgcgaatcggtggaagacctgttc
cgcgtggcggatatgatgcaacccattgcgcgccgccagaaggtatcgcgggtgctggaa
ggcgcggtgctgggcaacctgttcttcgaggccagcacgcgtactcgcgtcagcttcggc
gcggcgttctgccgcctgggcggttcggtctgcgacaccacgggcttcacgttctcgtcc
atggccaagggcgaatccatctacgataccagccgcgtgatgagcggctacgtcgacgcc
atggtcatccgccatcccgaacaggggtcggtggcggagttcgccgaggcgaccaatatt
ccggtggtcaatggcggcgatggcccgggcgaacatcccagccaggccctgctggacctg
tacaccatccttaccgagttctcgcgcctgggcaagctgctcgacggcgcgcacatcgcc
atggtcggcgacctgaagtacggccgcacggtgcactcgctgatcaagctgctggcgctg
tacaagggcgtgaagttcacgctgatttcgccgcagggcctggagatgcccggctacatc
gtcgagcaggccagccgcaacggcaatgtgatcgaacagaaaagcacgctggccgagggc
ctggcgggcgcggacgtcatttacgccacacgcgtgcagaaagagcgcttcgccaacgaa
gaggcgggcgaaggctatacggcggacttccaggtcagccgcgccatcatcgacgcctac
tgcggtccggataccatcgtcatgcaccccttgccgcgcgacagccggccggggtccaac
gatctgagcacggatctgaaccacgacccgcgcctggcgattttccgccagaccgacaat
ggcattccgatccggatggcgatcttcgcggtgctgctgggcgtggaagggctggtgcag
cattcgatgcgcgacgtgacgtggcagcatccgtcgcacatcggccccgacgactccgtc
ttccacggcctggactga

DBGET integrated database retrieval system