KEGG   Bordetella bronchiseptica RB50: BB2174Help
Entry
BB2174            CDS       T00141                                 

Gene name
purN
Definition
phosphoribosylglycinamide formyltransferase (EC:2.1.2.2)
Orthology
K11175  
phosphoribosylglycinamide formyltransferase 1 [EC:2.1.2.2]
Organism
bbr  Bordetella bronchiseptica RB50
Pathway
Purine metabolism
One carbon pool by folate
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:bbr00230]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:bbr00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
2320980..2321633
Genome map
AA seq 217 aa AA seqDB search
MSNPKRRLVILISGRGSNMQALVQACRGQSWPAEVAAVIASRPDAAGLDWARQQGIATAA
LYHKDYPSREAFDAALAREIDRHAPDYVLLAGFMRVLTPGFVNHYAGRLVNIHPSLLPAF
PGLHTHAQALATGVRAHGCTVHFVTPVLDHGPIIAQGCVPVLAGDTPEALAGRVLEVEHQ
VYPAAARWLAEGRVSLTADQRVEVAGEPQRLFFWPAA
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgtccaatcccaagcgccgcctcgtcatcctgatttccgggcgcggcagcaacatgcag
gccctggtgcaggcgtgccgcgggcagtcctggccggccgaagtggccgccgtgatcgcc
agccgcccggacgccgccggcctggattgggcgcgccagcaaggcatcgccacggcggcc
ctctaccacaaggactaccccagccgcgaggcgttcgacgccgcgctggcccgggagatc
gaccgccacgcgcccgattacgtgctgctggccggattcatgcgggtgctcacgccgggc
ttcgtcaatcactacgcgggccggctggtcaatatccatccttcgctgctgccggcgttt
cccggcctgcatacgcatgcgcaggccctggccaccggcgtgcgcgcgcatggttgcacg
gtgcatttcgtgacgcccgtgctcgaccacggccccatcatcgcgcagggctgcgtgccg
gtgctggcgggcgatacgcccgaggcgctggccgggcgcgtgctcgaggtcgaacaccag
gtctatccggcggcggcgcgctggctggccgaaggaagggtcagcctgaccgccgaccag
cgcgtcgaagtcgccggcgagccgcagcgcctctttttctggccggcggcgtaa

DBGET integrated database retrieval system