KEGG   Bordetella bronchiseptica RB50: BB2550Help
Entry
BB2550            CDS       T00141                                 

Gene name
cheB
Definition
chemotaxis-specific methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
bbr  Bordetella bronchiseptica RB50
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:bbr02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:bbr02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
2712401..2713453
Genome map
AA seq 350 aa AA seqDB search
MKKIKVLCVDDSALVRGLMTEIINSHPDMEVVATAPDPLVARELIKKHNPDVLTLDVEMP
RMDGLDFLEKLMRLRPMPVVMVSSLTERGGEITLRALELGAIDFVTKPKLGIRDGLIEYS
EVIADKIRAASRARLRAPAPAGHAAPLRLRSPFASSEKLVIVGASTGGTEAIREVLQPLP
ADSPAILITQHMPAGFTRSFAQRLDALCAVTVREASDGERVLPGHVYLAPGGETHMRLGR
SGANYVIGLQASEPVNRHRPSVDVLFHSAAEAAGGNAIGVILTGMGKDGAAGLLAMKRAG
ARTMAQDEASCVVFGMPREAIALGAADEVVPLADISERILTRLGDRGHRV
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagatcaaggtcttgtgcgtggacgattccgcgctggtgcgcggcctgatgacc
gagatcatcaacagccatccggacatggaggtggtcgcgaccgcgcccgatccgctggtg
gcgcgcgaactgatcaagaagcacaacccggacgtgctgacgctggatgtggaaatgccg
cgcatggacggcctggatttcctcgagaagctgatgcggctgcggcccatgccggtggtg
atggtgtcgtcgctgaccgagcgcggcggcgagatcacgctgcgggcgctggaactgggc
gcgatcgatttcgtgaccaagcccaagctggggatccgcgacggactgatcgagtattcc
gaggtgatcgcggacaagatccgcgccgcctcgcgcgcgcgcctgcgcgcgccggcgccg
gccggccacgcggcgccgctgcgcctgcgcagcccgttcgccagctccgagaagctggtg
atcgtgggcgcatcgaccggcggcaccgaagcgatccgcgaggtgctgcagcccctgccg
gccgacagcccggcgatcctcatcacccagcacatgccggccggcttcacgcgctcgttc
gcgcagcgcctggacgcgctgtgcgcggtgaccgtgcgcgaagccagcgacggcgagcgg
gtgctgcctggccacgtgtacctggcgccgggcggcgagacgcatatgcgcctgggccgc
agcggcgccaactacgtgatcgggctgcaggccagcgagccggtcaaccggcaccgcccc
tcggtggacgtgctgttccattcggccgccgaggcggccggcggcaatgcgatcggggtg
atactgaccggcatgggcaaggatggcgcggccggcttgctggccatgaaacgcgccggc
gcgcggaccatggcgcaggacgaggccagttgcgtggtcttcggcatgccgcgcgaggcc
atcgcgctgggcgcggccgacgaggtcgtgccgctggccgacatcagtgagcggattctg
acgcgtttgggcgaccgcgggcatcgcgtttga

DBGET integrated database retrieval system