KEGG   Bordetella bronchiseptica RB50: BB2775Help
Entry
BB2775            CDS       T00141                                 

Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
bbr  Bordetella bronchiseptica RB50
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bbr00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    BB2775
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BB2775
  Lipid metabolism
   00071 Fatty acid degradation
    BB2775
  Amino acid metabolism
   00350 Tyrosine metabolism
    BB2775
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BB2775
   00626 Naphthalene degradation
    BB2775
Enzymes [BR:bbr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BB2775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
2941485..2942639
Genome map
AA seq 384 aa AA seqDB search
MNGFEFRTHARTLAGEGASQRLGEAVAAQWGPCRILVVTDEQLVRLGLVAALAQSLRDAG
HTVQVYDGVLADPPEAVVSQAIARGRETDVQCVIGFGGGSSMDIAKLVAAFAGSAADFRD
SYGIDRVATARLPLVQVPTTAGTGSEATPIAIVTREDASKAGIVSPVLYCDIAVLDAALT
RGLPPAVTAATGIDAIVHAVEAYTSRLRKNPISDGLAREALRLLCRSIGPACRDGADMAA
RHDMLLGAMLAGQAFANAPVAAVHALAYPLGGVFHVPHGLSNALMFGAVLRFNLPQAGAA
YAQLAQIACPQVDGPQQARAEGFVQEMAGLGPRLGLPRRLAEVGVAERDLPMLAQQAMQQ
QRLLVNNPRELGYDDALRLYREAL
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgaacggattcgagtttcggacacatgcccgcacgctggcgggcgagggggcctcgcaa
cggttgggcgaggcggtcgcggcgcaatgggggccgtgccgcatcctggtcgtcacggac
gagcagctggtgcggctgggcctggtcgcggccctggcgcaaagcctgcgcgacgccggc
cacacggtccaggtctacgacggcgtgctggccgatccgcccgaagcggtggtgagccag
gcgatcgcgcggggccgggaaacggacgtgcaatgcgtgatcggcttcggcggcggctcg
tcgatggatatcgcgaaactggtggcggcgttcgccggctccgcggccgactttcgcgac
agctacggcatcgaccgcgtcgccacggcgcgcctgccgctggtgcaggtgccgaccacg
gccggcaccggctcggaagccacgcccatcgccatcgtgacccgcgaggacgcctccaag
gcgggcattgtctcccccgtcctgtactgcgacatcgccgtactggatgccgcgttgacc
cggggcctgccgccggccgtgaccgccgccaccggcatcgacgccatcgtgcacgccgtc
gaggcctataccagccggctgcgcaagaacccgatctccgatggcctggcgcgcgaggcg
ttgcgcctgctgtgccgttccatcggccccgcatgccgcgacggcgccgacatggcggcc
cgccatgacatgttgctgggcgcgatgctggcggggcaggcgttcgccaatgcgccggtg
gcggccgtgcatgcgctggcctatccgctgggcggcgttttccacgtgccgcacggcctg
tccaatgcattgatgttcggcgcggtgctgcgtttcaacctgccgcaggccggcgccgcc
tatgcccagcttgcgcagatcgcctgtccgcaggtcgacggcccgcagcaggcgcgcgcc
gaaggattcgtgcaggaaatggccggcctggggccgcgtctggggctgccgcggcgcctg
gccgaagtcggggtggccgaacgcgatctgcccatgctcgcgcaacaggccatgcagcaa
cagcgtttgctggtcaacaaccccagggagctcggctacgacgacgccttgcgcctttac
cgggaggcgttgtga

DBGET integrated database retrieval system