KEGG   Bordetella bronchiseptica RB50: BB2864Help
Entry
BB2864            CDS       T00141                                 

Gene name
glgB
Definition
glycogen branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
bbr  Bordetella bronchiseptica RB50
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bbr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BB2864 (glgB)
Enzymes [BR:bbr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     BB2864 (glgB)
Exosome [BR:bbr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BB2864 (glgB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
3031899..3034094
Genome map
AA seq 731 aa AA seqDB search
MMRDSPSIQGTLDAATQHALLAGRHADPFSVLGPHQAGAHTVVRVLAPGARTVMAVLPGG
QRTPLLPMQPGLFENTVPGLQPGAPAAYRLCIEWEGGIQHTADPYAFGPVLDAAQLDHCA
AGGWRYLAGLLGAHAASVDGCAGTRFALWAPNARRVAVVGDFNGWDGRRHAMRLRYPAGV
WELFLPDVGPGARYKFQVLGADGHTVLKADPLARQAEAPPATASIVPDERPFAWTDEAWM
EQRAARQRCDAPISIYEVHAGSWFDDAGAPRWQSLAARLPEYARSLGFTHIELLPVMAHP
FGGSWGYQPLGLFAPAAAHGAPADFAHFVDRCHEAGLGVILDWVPAHFPDDAHGLARLDG
TPLYEHADPREGRHPDWNTLIYNYGRREVRAFLIASAIHWLRHYHVDGLRVDAVASMLYR
DYSRPAGQWIPNRHGGRENLEAIDFLRELNAAVGVQCPGAITVAEESTAWPGVTAPVANG
GLGFDYKWNMGWMHDTLRYMRRDPIHRRHHHHDLSFGMVYAYAERFVLPLSHDEVVHGKG
SLLGKMPGERAAQLAQLRLYYAFMWAHPGKKLLFMGGEFGQQGEWNHDAMLQWSLLDDPA
HRGLQRLIADLNHVYATLPELHCRDADPSGFAWIVGDDADNSVLAFARVDASHCLVAVCN
FTPVPRPGYRFGVPHAGDWRVRVDTGATRYGGAGGGPPICLRSEPIPAHGHPQSLVLDLP
GFTALYLRHSE
NT seq 2196 nt NT seq  +upstreamnt  +downstreamnt
atgatgcgagattcgccttccatccagggcacgctggacgcggccacccagcacgcgctg
ctggccggccgccatgccgatccgttttccgtgctggggccgcaccaggccggcgcgcat
accgtggtgcgcgtgctggcgcccggcgcgcgcaccgtgatggccgtgctgcccggcggc
cagcgcacacccttgctgcccatgcagcccggcctgttcgaaaacaccgtgccgggcctg
cagccgggcgcgccggcagcctaccgactgtgcatcgaatgggagggaggcatccagcac
accgccgacccctacgcattcgggccggtgctcgacgccgcccagctcgaccattgcgcg
gccggcggctggcgctacctggccggcctgctgggcgcgcacgccgccagcgtggacggc
tgcgcgggcacccgcttcgcgctatgggcgcccaatgcccggcgcgtggcggtggtgggc
gatttcaacggctgggatggccggcgccacgccatgcgcctgcgctatccggcgggcgtc
tgggagctgttcctgcccgacgtggggccgggcgcgcgctacaaattccaggtgctgggc
gccgacggccataccgtgctcaaggccgacccgctggcgcgccaggccgaggcgccgcct
gccaccgcgtccatcgtccccgacgaacgccccttcgcgtggaccgacgaggcctggatg
gaacaacgcgcggcgcgccagcgttgcgacgcgccgatctccatctacgaagtgcatgcc
ggctcctggttcgacgacgccggcgcgccgcgctggcaaagcctggccgcccgcctgccc
gaatacgcgcgctcgctgggcttcacccatatcgagctgctgcccgtgatggcgcatccc
ttcggcggttcgtggggctaccagccgctcggactgttcgcgccggcggccgcgcacggc
gcgccggccgacttcgcgcatttcgtcgaccgttgccacgaggccgggctgggcgtcatc
ctggactgggttccggcccacttccccgacgacgcgcacgggctggcgcgcctggacggc
acgccgctctacgagcacgccgacccgcgcgaaggccgccatcccgactggaacacgctg
atctacaactacggccgccgcgaggtgcgggcctttctcatcgccagcgccatccactgg
ctgcgccattaccatgtagacgggctgcgcgtggacgcggtcgcgtccatgctgtatcgc
gactacagccgcccggccggccagtggatccccaaccgccacggcgggcgcgagaatctc
gaagccatcgacttcctgcgcgaactcaacgccgccgtgggcgtccagtgccccggcgcc
atcaccgtggccgaggagtccaccgcctggcccggcgtgaccgcgccggtggccaacggc
ggtctgggcttcgactacaagtggaacatgggctggatgcacgacacgctgcgctacatg
cggcgcgatccgatccatcgccgccatcaccaccacgatctcagcttcggcatggtctat
gcctatgccgaacgcttcgtgctgccgctctcgcatgacgaagtggtgcacggcaagggc
tcgctgctgggcaagatgccgggcgagcgggccgcccagctggcccagttgcggctgtac
tacgccttcatgtgggcccatcccggcaagaagctgctgttcatgggcggcgagttcggc
cagcaaggcgagtggaaccacgacgccatgctgcagtggtcgttgctggacgatccggcc
catcgcgggctgcagcgcctgatcgcggatctcaaccacgtctacgccaccctgcccgaa
ctgcattgccgcgacgccgacccgagcggcttcgcctggatcgtcggcgacgacgcggac
aacagcgtgctcgccttcgcccgcgtggacgccagccattgcctggtggccgtgtgcaac
ttcacgccggtgccgcgaccgggctatcgcttcggcgtaccccacgcgggcgactggcgc
gtacgcgtggacaccggggcgacgcgctacggcggcgccggcggcggtccgcccatctgc
ctgcgcagcgaacccatcccggcccatgggcacccgcaatcgctggtcctggacctgccc
ggcttcaccgcgctgtacctgcgccactcggagtaa

DBGET integrated database retrieval system