KEGG   Bordetella bronchiseptica RB50: BB2887Help
Entry
BB2887            CDS       T00141                                 

Definition
glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
bbr  Bordetella bronchiseptica RB50
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:bbr00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:bbr00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
3060748..3061248
Genome map
AA seq 166 aa AA seqDB search
MNTMYDFSAPTITGAERALADFRGQVALVVNVASRCGFTPQYSGLEELYRSYRNEGFVVL
GFPCNQFGRQEPDDEAAIAQFCETQYAISFPLFAKIDVNGAHAHPLYRWLKARKPGLLGT
RAIKWNFTKFLVGRDGLPLRRYAPAHTPESLRHDIARACAAPGPTP
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgaacaccatgtacgacttcagcgcccccaccataacgggcgcggaacgcgcgctggcc
gattttcgcggccaggtggcgctggtggtcaatgtcgcctcgcgctgcgggttcacgccc
cagtactcgggcctggaagaactgtaccgctcgtaccgcaacgaaggctttgtcgtcctg
ggatttccgtgcaaccagttcgggcgccaggagccggacgacgaggccgccatcgcgcag
ttctgcgaaacccagtacgccatcagcttcccgctgttcgccaagatcgacgtcaacggc
gcccacgcccacccgctgtaccgctggctgaaggcacgcaagcccggcctgctgggcacc
cgcgccatcaaatggaatttcaccaaattcctggtcgggcgcgacggcctgccgctgcgg
cgctacgcgcccgcccacacgcccgaatcgctgcgccacgacatcgcgcgcgcctgcgcc
gcgcccggcccgacgccctag

DBGET integrated database retrieval system