KEGG   Bordetella bronchiseptica RB50: BB2887Help
Entry
BB2887            CDS       T00141                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
bbr  Bordetella bronchiseptica RB50
Pathway
bbr00480  Glutathione metabolism
bbr00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:bbr00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    BB2887
  Metabolism of other amino acids
   00480 Glutathione metabolism
    BB2887
Enzymes [BR:bbr01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     BB2887
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA
Motif
Other DBs
NCBI-ProteinID: CAE33379
GeneDB: BB2887
UniProt: A0A0H3LWH9
Position
3060748..3061248
Genome map
AA seq 166 aa AA seqDB search
MNTMYDFSAPTITGAERALADFRGQVALVVNVASRCGFTPQYSGLEELYRSYRNEGFVVL
GFPCNQFGRQEPDDEAAIAQFCETQYAISFPLFAKIDVNGAHAHPLYRWLKARKPGLLGT
RAIKWNFTKFLVGRDGLPLRRYAPAHTPESLRHDIARACAAPGPTP
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgaacaccatgtacgacttcagcgcccccaccataacgggcgcggaacgcgcgctggcc
gattttcgcggccaggtggcgctggtggtcaatgtcgcctcgcgctgcgggttcacgccc
cagtactcgggcctggaagaactgtaccgctcgtaccgcaacgaaggctttgtcgtcctg
ggatttccgtgcaaccagttcgggcgccaggagccggacgacgaggccgccatcgcgcag
ttctgcgaaacccagtacgccatcagcttcccgctgttcgccaagatcgacgtcaacggc
gcccacgcccacccgctgtaccgctggctgaaggcacgcaagcccggcctgctgggcacc
cgcgccatcaaatggaatttcaccaaattcctggtcgggcgcgacggcctgccgctgcgg
cgctacgcgcccgcccacacgcccgaatcgctgcgccacgacatcgcgcgcgcctgcgcc
gcgcccggcccgacgccctag

DBGET integrated database retrieval system