KEGG   Bordetella bronchiseptica RB50: BB3006Help
Entry
BB3006            CDS       T00141                                 

Gene name
tesA
Definition
acyl-CoA thioesterase (EC:3.1.2.-)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
bbr  Bordetella bronchiseptica RB50
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:bbr00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    BB3006 (tesA)
Enzymes [BR:bbr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     BB3006 (tesA)
   3.1.2  Thioester hydrolases
    3.1.2.-  
     BB3006 (tesA)
Lipid biosynthesis proteins [BR:bbr01004]
 Fatty acid synthase
  Component type
   BB3006 (tesA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
3210845..3211393
Genome map
AA seq 182 aa AA seqDB search
MVGDSLSAEYGLRRGSGWVPMLAQRVSQQYPNYRVVNASISGDTTSGGLARLPALLRQHA
PAVVVLELGSNDALRGLALDMTERNLRAMAQASRQAGASVLVVGMQIPPNYGRDYTQRFA
QVFPAVAEQEKARLVPFLMEGIATNRAMFQADGIHPNEDAQPALLDNVWPVLEPMLAQPA
AD
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
gtggtcggcgacagcctgtcggccgaatacggcctgcggcgcgggtccggctgggtgccg
atgctggcccagcgggtttcgcaacaataccccaactaccgcgtcgtcaatgccagcatc
agcggcgatacgaccagcggcgggctggcgcgcctgccggcgctgctgcgccagcacgcg
ccggccgtcgtcgtgctggaactggggtccaacgatgccctgcgcggcctggcgctggac
atgaccgagcgcaatctgcgcgccatggcgcaggcgtcgcgccaggccggcgcatcggtg
ctggtggtcggcatgcagatcccgccgaactacggccgcgactacacccagcgcttcgcg
caggtctttccagccgtggccgaacaggaaaaagcccggctggtgccgttcctcatggaa
ggaatcgccaccaaccgggccatgttccaggccgacggcatccatcccaacgaggatgcc
cagccggcgctgcttgacaatgtctggcccgtgctcgagccgatgctggctcagcccgcg
gccgactga

  All links  
No link information was found.   
DBGET integrated database retrieval system