KEGG   Bordetella bronchiseptica RB50: BB3339Help
Entry
BB3339            CDS       T00141                                 

Gene name
aceA
Definition
(GenBank) putative isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
bbr  Bordetella bronchiseptica RB50
Pathway
bbr00630  Glyoxylate and dicarboxylate metabolism
bbr01100  Metabolic pathways
bbr01110  Biosynthesis of secondary metabolites
bbr01120  Microbial metabolism in diverse environments
bbr01200  Carbon metabolism
Module
bbr_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bbr00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BB3339 (aceA)
Enzymes [BR:bbr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     BB3339 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase DUF3338
Motif
Other DBs
NCBI-ProteinID: CAE33831
GeneDB: BB3339
UniProt: A0A0H3LXI7
Position
complement(3565251..3566573)
Genome map
AA seq 440 aa AA seqDB search
MSNRETEIRNLQKDWAENTRWQGIKRAYSAEDVIRLRGSVAVEHSLARRGATRLWDSLHS
EPFVNSLGALTGNQAMQQVKAGLKAIYLSGWQVAGDANLAGEMYPDQSLYPANSVPQVVR
RINNALARCDQIQWMEGKNPGDQDYIDYYAPIVADAEAGFGGVLNAFELMKAMIEAGAAG
VHFEDQLASVKKCGHMGGKVLVPTREAVSKLVSARLAADVMGTPTILLARTDADAADLVT
SDVDENDRPFITGERTVEGFFRTRAGLDQAISRGLAYAPYADLIWCETSTPNLEYARKFA
EAVHRQFPGKLLAYNCSPSFNWKKNLDDGTIAKFQRELGAMGYKFQFITLAGFHALNYGM
FELAHGYARRQMSAFVELQQKEFAAAELGFTAVKHQREVGTGYFDAVTQTIEGGQSSTTA
LTGSTEEAQFEHGGQAVKAA
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatcgcgaaaccgaaatccgcaacttgcagaaagactgggccgagaacacccgc
tggcagggcatcaagcgcgcctacagcgccgaggatgtgatccgcctgcgcggctcggtg
gccgtcgagcattcgctggcgcgccgcggcgcgacccgcttgtgggattcgttgcatagc
gagcccttcgtcaattcgctgggcgcgttgaccggcaaccaggccatgcagcaggtcaag
gccggcctgaaggccatctacctgtccggctggcaggtggccggcgacgccaacctggcc
ggcgagatgtacccggaccagtcgctgtaccccgccaactcggtgccgcaggtggtgcgc
cggatcaacaacgccctggcgcgttgcgaccagatccagtggatggaaggcaagaacccg
ggcgaccaggattacatcgattactacgcgcccatcgtggccgatgccgaggccggtttc
ggcggcgtgctcaatgccttcgaactgatgaaggccatgatcgaggcgggcgcggccggc
gtgcacttcgaagaccagctggcttccgtgaagaagtgcggccacatgggcggcaaggtg
ctggtgccgacccgcgaggccgtgtccaagctggtctcggcccgcctggccgccgacgtg
atgggcacgcccaccatcctgctggcccgcaccgacgccgacgcggccgacctggtgacc
agcgacgtggatgagaacgatcgcccgttcatcaccggcgagcgcacggtggaaggcttc
ttccgcacccgcgccggcctggaccaggcgatttcgcgcggcctggcctacgcgccgtat
gccgacctgatctggtgcgaaacctccacgcccaacctggagtatgcgcgcaagttcgcc
gaggccgtccatcgccagttcccgggcaagctgctggcgtacaactgctcgccctcgttc
aactggaagaagaacctggacgacggcacgatcgccaagttccagcgcgaactcggtgcg
atgggctacaagttccagttcatcacgctggccggtttccacgcgctgaactacggcatg
ttcgaactggctcacggttacgcgcgccgccagatgagcgctttcgtggagctgcagcag
aaggaattcgccgccgccgagctgggctttaccgcggtcaagcaccagcgcgaagtcggc
accggctacttcgacgccgtgacccagacgatcgaaggcggccagtcctcgaccacggcc
ctgaccggctcgaccgaggaagcgcagttcgagcacggcgggcaggccgtcaaggcggcg
tga

DBGET integrated database retrieval system