KEGG   Bordetella bronchiseptica RB50: BB3344Help
Entry
BB3344            CDS       T00141                                 

Gene name
nagZ
Definition
beta-hexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
bbr  Bordetella bronchiseptica RB50
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:bbr00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:bbr00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
complement(3571541..3572602)
Genome map
AA seq 353 aa AA seqDB search
MSSKKKTKPVLPPGPVMVDVAGTTLTKDEKRRLRNPLVGGVILFARNFTDRRQLCALTRA
IHKARKEPLLIAVDHEGGRVQRFRDDGFTALPPMQELGKLWDRDPLAAMRLATEAGYVLA
AELRACGVDLSFTPVLDLDYGVSKVIGNRAFHHDARVVTMLSRALAQGLALAGMAACGKH
FPGHGFVGADSHHEIPVDPRPLARILKDDAAPYAWLGDLVMPAVMPAHVIYPKVDAQPAG
FSRRWVSEILRERLGYDGVVFSDDLTMEGASVAGDILARAEAALGAGCDMVLVCNRPDLA
DELLDRLQVQHPAASVERIRRLMPRFAAPDWDTLQNDSRYQHARRLQSQIVSG
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgtccagcaagaagaaaaccaagcccgtcctgcctcccggccccgtcatggtggatgtg
gccggcacgacgctgaccaaggacgagaagcgccgcctgcgcaaccccctggtgggcggg
gtgatcctgttcgcgcgcaatttcaccgatcgccggcaattgtgcgcgctgacgcgggcc
atccacaaggcgcgcaaggagccgctgctgatcgcggtggaccacgaaggcggccgcgtg
cagcgctttcgcgacgacggctttaccgcgttgccgcccatgcaggagctgggcaagctg
tgggaccgcgatccgctggcggcgatgcggctggcgaccgaggccggctacgtgctggcc
gccgagctgcgcgcctgcggcgtcgatctcagcttcacgccggtattggacctcgactac
ggcgtgagcaaggtgatcggcaatcgcgccttccaccatgacgcgcgcgtggtcaccatg
ctgtcgcgcgcgctggcgcagggcctggcgctggcgggcatggcggcctgcggcaagcat
ttccccggccatggtttcgtgggcgccgattcgcaccacgagatcccggtcgatccgcgg
ccgctcgcgcgcatcctgaaggatgacgcggcgccttacgcctggctgggcgacctggtc
atgccggctgtcatgccggcgcatgtgatctatccgaaggtcgatgcccagcccgcgggt
ttttcgcgccgctgggtcagcgagatcctgcgcgaacggctgggctacgatggcgtggtg
ttctccgacgatctgaccatggagggcgcgtcggtggcgggcgacatcctggcccgcgcc
gaggcggccctgggcgccggctgcgacatggtgctggtatgcaaccgcccggacctggcc
gacgagctgctggaccgcctgcaggtccagcatccggccgcctcggtcgagcgcatccgc
cggctgatgccgcggttcgccgcgccggactgggacactttgcagaatgacagccgctat
cagcatgcccgacgacttcaatctcaaatcgtttctggctga

DBGET integrated database retrieval system