KEGG   Bordetella bronchiseptica RB50: BB3361Help
Entry
BB3361            CDS       T00141                                 

Definition
malonyl-CoA decarboxylase
Orthology
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
bbr  Bordetella bronchiseptica RB50
Pathway
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bbr00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BB3361
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BB3361
Enzymes [BR:bbr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.9  malonyl-CoA decarboxylase
     BB3361
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
complement(3590535..3591671)
Genome map
AA seq 378 aa AA seqDB search
MFEARLTDVRANKLAQAWRLAYEQADGKRRRAMLGGLAQVGAGMQGDGAQGTRLFKRFNA
LPDGLRFLVALRADMLRWRKQVAGLQALDKELEALLSAWFDVGLLELRPLTWDSPASLLE
KLILYEAVHEIRSWDDLRHRVAGDRRCYAYFHPQMPDVPLIFVEVAFSAQMADNVQALLD
TSAPPQDLDKARWAIFYSISNTQPGLRGISFGNFLLKRVIDRLLQELPKLKFFATLSPIP
GFADWLSRLDAQEVEQAVRDKARTRSGAPDGARWVARLARAATGKPSEVVQRAGLRLAAR
YLQAMRAGQPLDPVARFHLGNGARIERLNWAADTSAKGLAQSCGMMVNYLYELGDLDGNL
ARLNEGKPQVSRGIARLG
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
ttgttcgaggcgcgcctgaccgatgtgcgcgccaacaaactggcgcaggcctggcgcctg
gcctatgagcaggccgacggcaagcggcgccgcgccatgctgggcgggctggcgcaggtc
ggcgccggcatgcagggcgacggcgcgcagggcacgcgcctgttcaaacggttcaatgcc
ttgcccgacggactgcgtttcctggtggcgctgcgcgccgacatgctgcgctggcgcaag
caggtcgccggactgcaggccctggacaaggagctggaggcgctgctgtcggcctggttc
gacgtgggcctgctggagctgcgcccgctgacctgggactcgcccgcctcgctgctcgag
aagctgatcctctacgaggccgtgcacgaaatccgctcgtgggacgatctgcgccatcgg
gtggcgggcgaccgccgctgctacgcgtatttccatccgcagatgccggacgtgccgctg
atcttcgtggaggtggcgttttcggcccagatggccgacaacgtccaggcgctgctcgac
accagcgcgccgccgcaggacctggacaaggcgcgctgggcgatcttctattccatctcg
aatacgcagcccggcctgcgcgggatcagcttcggcaacttcctgctcaagcgcgtgatc
gaccgcctgctgcaggagctgcccaagctgaaattcttcgccacgctgtcgcccattccc
ggcttcgccgactggctgtcgcggctggacgcgcaggaggtcgagcaggcggtgcgcgac
aaggcgcgcacgcgcagcggcgctccggatggcgcgcgctgggtggcgcggctggcgcgc
gcggccacgggcaagccgtcggaagtggtgcagcgagccggcctgcgcctggccgcgcgc
tacctgcaggcgatgcgggccggccagccgctcgacccggtggcccgtttccacctgggc
aacggcgcgcgcatcgagcgcctgaactgggctgccgatacctcggccaagggcctggcg
cagtcctgcggcatgatggtgaactacctctacgagctgggcgacctggatggcaacctg
gcccgcctgaacgaaggcaagccgcaagtcagccgcggcatcgcgcgcctgggatga

DBGET integrated database retrieval system