KEGG   Bordetella bronchiseptica RB50: BB3456Help
Entry
BB3456            CDS       T00141                                 

Gene name
etfA
Definition
electron transfer flavoprotein subunit alpha
Orthology
K03522  
electron transfer flavoprotein alpha subunit
Organism
bbr  Bordetella bronchiseptica RB50
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
complement(3700231..3701160)
Genome map
AA seq 309 aa AA seqDB search
MTTLVIAEHDNAQLKGATLNTIAAASRLGGEVHVLVAGSGAQAVAEQAAQAAGVSKVLLA
DAPQLAEGLAENLAAQVLAVAGGYSHILFAATASGKNVAPRVAAKLDVAQISDIIGVESA
DTFQRPIYAGNAIATVQSGDAVKVITVRTTGFDAVAAQGGSAAVEALDAVADSGLSRFVG
REVAKSDRPELAGARVVVSGGRGLGSAENFKILDPLADKLGAALGASRAAVDAGYAPNDW
QVGQTGKIVAPQLYVAVGISGAIQHLAGMKDSKVIVAINKDPEAPIFGVADYGLVGDLFQ
VVPELTGAL
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgctggtaatagccgaacacgataacgcgcagctgaagggcgcgacgctgaac
acgatcgccgcggcgtccaggctgggcggcgaggtgcatgtgctggtggcgggctcgggc
gcgcaggcggtggccgagcaggccgcgcaggcggccggggtgtccaaggtgctgctggcc
gatgcgccgcagctggccgaggggctggccgagaacctggccgcgcaggtgctggcggtg
gctggcgggtacagccacattctgttcgcggccacggcctcgggcaagaacgtggcgccg
cgggtggcggccaagctggatgtggcgcagatctcggacatcatcggagtggagtcggcc
gatacgttccagcggccgatctacgcgggcaacgcgatcgccacggtgcagtcgggcgat
gcggtcaaggtgatcacggtgcgcacgaccggttttgacgcggtggccgcgcagggcggg
tcggcggcggtcgaggcgctcgatgcggtggccgattcggggctgtcgcgcttcgtgggc
cgggaggtggccaagagcgaccgtccggagctcgccggcgcgcgggtggtggtctcgggc
gggcgcgggctgggcagcgcggagaacttcaagatcctggacccgctggccgacaagctg
ggcgcggcgctgggggcctcgcgcgcggcggtggacgcgggctacgcgcccaacgactgg
caggtggggcagacgggcaagatcgtggcgccgcagctgtacgtggcggtgggcatctcc
ggggcgatccagcacctggcgggcatgaaggactccaaggtcatcgtggccatcaacaag
gatccggaagcgccgatcttcggcgtggccgactacggcctggtgggcgacctgttccag
gtcgtgcccgagctgaccggcgcgctctga

DBGET integrated database retrieval system