KEGG   Bordetella bronchiseptica RB50: BB3456Help
Entry
BB3456            CDS       T00141                                 

Gene name
etfA
Definition
electron transfer flavoprotein subunit alpha
Orthology
K03522  
electron transfer flavoprotein alpha subunit
Organism
bbr  Bordetella bronchiseptica RB50
Brite
Exosome [BR:bbr04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   BB3456 (etfA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
complement(3700231..3701160)
Genome map
AA seq 309 aa AA seqDB search
MTTLVIAEHDNAQLKGATLNTIAAASRLGGEVHVLVAGSGAQAVAEQAAQAAGVSKVLLA
DAPQLAEGLAENLAAQVLAVAGGYSHILFAATASGKNVAPRVAAKLDVAQISDIIGVESA
DTFQRPIYAGNAIATVQSGDAVKVITVRTTGFDAVAAQGGSAAVEALDAVADSGLSRFVG
REVAKSDRPELAGARVVVSGGRGLGSAENFKILDPLADKLGAALGASRAAVDAGYAPNDW
QVGQTGKIVAPQLYVAVGISGAIQHLAGMKDSKVIVAINKDPEAPIFGVADYGLVGDLFQ
VVPELTGAL
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgctggtaatagccgaacacgataacgcgcagctgaagggcgcgacgctgaac
acgatcgccgcggcgtccaggctgggcggcgaggtgcatgtgctggtggcgggctcgggc
gcgcaggcggtggccgagcaggccgcgcaggcggccggggtgtccaaggtgctgctggcc
gatgcgccgcagctggccgaggggctggccgagaacctggccgcgcaggtgctggcggtg
gctggcgggtacagccacattctgttcgcggccacggcctcgggcaagaacgtggcgccg
cgggtggcggccaagctggatgtggcgcagatctcggacatcatcggagtggagtcggcc
gatacgttccagcggccgatctacgcgggcaacgcgatcgccacggtgcagtcgggcgat
gcggtcaaggtgatcacggtgcgcacgaccggttttgacgcggtggccgcgcagggcggg
tcggcggcggtcgaggcgctcgatgcggtggccgattcggggctgtcgcgcttcgtgggc
cgggaggtggccaagagcgaccgtccggagctcgccggcgcgcgggtggtggtctcgggc
gggcgcgggctgggcagcgcggagaacttcaagatcctggacccgctggccgacaagctg
ggcgcggcgctgggggcctcgcgcgcggcggtggacgcgggctacgcgcccaacgactgg
caggtggggcagacgggcaagatcgtggcgccgcagctgtacgtggcggtgggcatctcc
ggggcgatccagcacctggcgggcatgaaggactccaaggtcatcgtggccatcaacaag
gatccggaagcgccgatcttcggcgtggccgactacggcctggtgggcgacctgttccag
gtcgtgcccgagctgaccggcgcgctctga

DBGET integrated database retrieval system