KEGG   Bordetella bronchiseptica RB50: BB3668Help
Entry
BB3668            CDS       T00141                                 

Gene name
odhB
Definition
(GenBank) 2-oxoglutarate dehydrogenase complex, E2 component
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bbr  Bordetella bronchiseptica RB50
Pathway
bbr00020  Citrate cycle (TCA cycle)
bbr00310  Lysine degradation
bbr01100  Metabolic pathways
bbr01110  Biosynthesis of secondary metabolites
bbr01120  Microbial metabolism in diverse environments
bbr01130  Biosynthesis of antibiotics
bbr01200  Carbon metabolism
Module
bbr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bbr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bbr00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BB3668 (odhB)
  Amino acid metabolism
   00310 Lysine degradation
    BB3668 (odhB)
Enzymes [BR:bbr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     BB3668 (odhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H
Motif
Other DBs
NCBI-ProteinID: CAE35641
GeneDB: BB3668
UniProt: A0A0H3LYV3
Position
complement(3881417..3882637)
Genome map
AA seq 406 aa AA seqDB search
MAITDVLVPQLSESVSEATLLTWKKQAGAAVEADEILIEIETDKVVLEVPAPSSGVLSEI
VMGDGSTVTSGEVIARIDTAAKAAAAPAAAAEAPAAAAAAAPAAAAPAAASSTASGVASP
AAAKILAEKGVDAASVAGTGRDGRVTKGDALAAGNAPAAKAAAPVAPPTLSLDGRPEQRV
PMSRLRARIAERLLQSQAENAILTTFNEVNMQAVMDLRARYKDKFEKEHGVKLGFMSFFV
KAAVAALKKYPVLNASVDGKDIIYHGYFDIGIAVGTPRGLVVPILRNADQLTIAEIEKTI
ADFGKRAADGKLGIEEMTGGTFSISNGGVFGSMLSTPIINPPQAAILGIHATKERPVVEN
GQIVIRPINYLAMSYDHRIIDGREAVLGLVAMKEALEDPQRLLLDL
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atggctattaccgacgttctcgtccctcaactgtccgaatcggtttcggaagccacgctg
ctgacctggaagaagcaggcgggcgccgcggtcgaggccgacgaaatcctgatcgaaatc
gagaccgacaaggtggtgctggaagtgccggccccgtcgtcgggcgtgctgtccgaaatc
gtcatgggtgacggcagcaccgtgacctcgggcgaagtcattgcccgcatcgacacggcc
gccaaggctgctgcggcgcctgccgccgctgccgaagcgcccgccgccgctgctgctgct
gcgccggccgccgccgcgccggcggcggccagcagcaccgccagcggcgtggcctcgccg
gccgccgccaagatcctcgccgagaagggcgtggacgccgccagcgtggccggcaccggc
cgcgacggccgcgtcaccaagggcgacgccctggccgcgggcaacgcgcccgccgccaag
gccgccgcgccggtggcgccgcccacgctgtcgctggacggccgccccgagcagcgcgtg
ccgatgagccgcctgcgcgcccgcatcgccgagcgcctgctgcaatcgcaagccgagaac
gccatcctgacgacgttcaacgaagtcaacatgcaggccgtgatggacctgcgcgcccgc
tacaaggacaagttcgagaaagagcacggcgtcaagctgggcttcatgtcgttcttcgtc
aaggccgccgtcgccgcgctgaagaagtacccggtgctcaacgcctcggtcgacggcaag
gacatcatctaccacggctacttcgacatcggcatcgccgtcggcaccccgcgtggcctg
gtggtgcccatcctgcgcaacgccgaccagctgaccatcgccgaaatcgagaagaccatc
gccgacttcggcaagcgcgccgcggacggcaagctgggcatcgaggaaatgaccggcggc
acgttctcgatctccaacggcggggtgttcggctcgatgctgtccacgcccatcatcaac
ccgccgcaggcggccatcctgggcatccacgccaccaaggagcgcccggtggtcgagaac
ggccagatcgtcatccggccgatcaactacctggccatgtcctatgaccaccgcatcatc
gacggccgcgaagccgtgctgggcctggtggccatgaaggaagcgctggaagacccgcaa
cgcctgttgctggatctgtaa

DBGET integrated database retrieval system