KEGG   Bordetella bronchiseptica RB50: BB3681Help
Entry
BB3681            CDS       T00141                                 

Gene name
sdhD
Definition
succinate dehydrogenase hydrophobic membrane anchor protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
bbr  Bordetella bronchiseptica RB50
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:bbr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BB3681 (sdhD)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BB3681 (sdhD)
   00650 Butanoate metabolism
    BB3681 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    BB3681 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
complement(3900423..3900806)
Genome map
AA seq 127 aa AA seqDB search
MADTKNYGPKRLVVGAHYGVTDFIAQRITAVILAVYTLVLIVGLLIMPAFTYENWKALFT
FHVFALPVGQILASLAFFALAWHAWIGVRDIWMDYVRPVGVRLLLQVLTILWLVGSVVYF
AQILWRI
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atggccgatacgaaaaactatggccccaagcgcctggtcgtcggcgcccactacggggtt
accgatttcatcgcccagcgcatcaccgccgtcatcctggccgtgtataccctggtgctg
atcgtcggcctgctgatcatgccggctttcacgtatgaaaactggaaggccctgttcacc
ttccacgtgttcgcccttccggtgggccagatcctggcctcgctcgctttctttgcgctg
gcctggcatgcctggatcggcgtgcgcgacatctggatggactatgtccgcccggtaggc
gtgcgcctgctgctgcaggtgctgaccatcctctggctggtcggttcggtcgtctacttc
gcgcaaatcctctggagaatctaa

DBGET integrated database retrieval system