KEGG   Bordetella bronchiseptica RB50: BB3695Help
Entry
BB3695            CDS       T00141                                 

Definition
AMP-binding protein
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bbr  Bordetella bronchiseptica RB50
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bbr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BB3695
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BB3695
   00620 Pyruvate metabolism
    BB3695
   00640 Propanoate metabolism
    BB3695
  Energy metabolism
   00680 Methane metabolism
    BB3695
Enzymes [BR:bbr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     BB3695
Lipid biosynthesis proteins [BR:bbr01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   BB3695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
3915426..3917090
Genome map
AA seq 554 aa AA seqDB search
MNDQYEALYQTFRWLVPTQFNIADACCHRWAASSPDARRIAIYYEDEAGNREVWTYARLA
EAANQLANGLVKMGVERGDRVGVVLGQRPETVVAHMAIYSVGAVVLPLSPLFGPEALESR
LRDADARVAIVDYASSANLLAISDNCPNLHQIIGIGFADERVLPWRSLLARQPNEFKMVA
TRASDPAILMYTSGTTGAPKGALLPHSVLIGNLPGFVASQDWFPRPGDVFWSPADWAWTG
GMMDALLPTLYFGHPIVGTRGRFTPERAFELMERYQVTNTFLFPTALKMMMKSVPEPRGR
YQLALRSIMSAGESVGETVFEWCEQALGITPNEMFGQTELNYVVGNSNRRWPARPGSMGR
PYPGHRVAVIDEAGRPVKPGETGEVALNRFDIHGFPDPVLFLGYWRNEAATAAKFTDDWC
RTGDLASIDADGYLWYAGRADDVFKSAGYRIGPGEIENCLLGHPAVANAAVVPKPDAERG
ALVKAYVVLTPEYQGRDPDSITQVLQEHVRDRLAPYEYPKEIEYVDALPMTTTGKIQRAV
LRRREAERASGAHS
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaccaatacgaggcgctgtaccaaaccttccgctggctggttccgacccagttc
aatatcgcggacgcctgctgccaccgctgggccgccagcagtccggacgcacgccgtatc
gccatctactacgaagacgaagcgggcaaccgcgaggtctggacctacgcgcgcctggcc
gaagccgccaaccagctggccaatggcctggtgaagatgggcgtggagcgcggcgaccgc
gtgggtgtggtattgggacaacgtccggagaccgtcgtcgcccacatggcgatctacagc
gtcggcgccgtggtactgccgctgtcgcccctgttcggcccggaggcgctcgaatcgcgc
ctgcgcgacgccgacgcgcgggtggccatcgtggactacgcctccagcgccaacctgctg
gccatcagcgacaactgccccaacctgcaccagatcatcggcatcggcttcgccgacgag
cgggtgctgccctggcgcagcctgctggcgcgccagccgaacgaattcaagatggtggcc
acgcgcgcgtccgacccggccatcctgatgtacacgtccggcaccaccggcgcccccaag
ggcgcgctgctgccgcacagcgtgctgatcggcaacctgcccggcttcgtcgcgtcccag
gactggtttccccggcccggcgacgtcttctggtcgccggcggactgggcctggacgggg
ggcatgatggacgccctgctgccgaccctgtatttcggccaccccatcgtcggcacgcgc
gggcgctttacgccggaacgcgccttcgagctgatggagcgctaccaggtcaccaatacc
ttcctgttcccgaccgcgctgaagatgatgatgaagtcggtgcccgagccgcgcggccgc
taccagctggcgctgcgcagcatcatgagcgccggcgaaagcgtaggcgaaaccgtgttc
gagtggtgcgagcaggcgctgggcatcacgcccaacgagatgttcggccagaccgagctg
aactacgtggtgggcaacagcaaccggcgctggccggcgcgccccggcagcatgggccgg
ccctatccgggccatcgggtcgccgtcatcgacgaagcgggccggccggtcaagcccggc
gaaacgggcgaagtggcgctcaaccggttcgatatccacggcttccccgatccggtgctg
ttcctgggctactggcgcaacgaggccgcgaccgccgcgaagttcacggacgattggtgc
cgcaccggcgacctggccagcatcgacgccgacggctacctctggtatgccggacgggcc
gacgatgtgttcaagtcggccggctaccggatcggcccgggcgagatcgagaactgcctg
ctgggccatcccgcggtagccaatgcggcggtcgtgcccaagcccgacgccgaacgcggc
gccctggtcaaggcctatgtggtgctgacgcccgagtaccagggccgcgacccggacagc
atcacccaggtgctgcaggagcacgtgcgcgaccgcctggctccctacgaataccccaag
gaaatcgaatacgtcgatgccttgcccatgaccactaccggaaaaatccagcgcgccgta
ctgcgccgccgcgaggccgaacgcgccagcggcgctcactcctga

DBGET integrated database retrieval system