KEGG   Bordetella bronchiseptica RB50: BB3725Help
Entry
BB3725            CDS       T00141                                 

Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bbr  Bordetella bronchiseptica RB50
Pathway
bbr00010  Glycolysis / Gluconeogenesis
bbr00620  Pyruvate metabolism
bbr00640  Propanoate metabolism
bbr00680  Methane metabolism
bbr01100  Metabolic pathways
bbr01110  Biosynthesis of secondary metabolites
bbr01120  Microbial metabolism in diverse environments
bbr01130  Biosynthesis of antibiotics
bbr01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bbr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BB3725
   00620 Pyruvate metabolism
    BB3725
   00640 Propanoate metabolism
    BB3725
  Energy metabolism
   00680 Methane metabolism
    BB3725
Enzymes [BR:bbr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     BB3725
Lipid biosynthesis proteins [BR:bbr01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   BB3725
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: CAE35699
GeneDB: BB3725
UniProt: A0A0H3M171
Position
complement(3947321..3949366)
Genome map
AA seq 681 aa AA seqDB search
MAIRLRVGKKNGSTRIIHRRHTMSNAIQSVLVENRVFPPPASAVQGAAISGMDAYWALCE
EADKDFNGFWSRLARENLQWSKPFTQVLDESEAPFYRWFGDGELNVSANCLDVHLHNGNA
DKTAIIFESDDGKVDKISYRELLARVCRFANGLKAMGYKKGDRAIIYMPMSIEAVVAMQA
CARLGVTHSVVFGGFSAKSLQERIVDVGATVVITADEQVRGGKTIPLKPAVEEAFAMGGC
EAVSKVVVYRRTGGKIAWQEGRDVWMHDVEAGQADTCEPQAVNAEHPLFILYTSGSTGKP
KGVQHASAGYLLWALLTMKWTFDARADDVYWCTADVGWVTGHTYITYGPLAAGVTQVVFE
GVPTFPNAGRFWDMIARHKVSVFYTAPTAIRSLIKAAEANQEVHPRQYDLDSLRIIGSVG
EPINPEAWIWYHKNVGRERCPVVDTWWQTETGGHMLTPLPGATPLKPGSCTLPLPGIVAA
IVDETGGDVAQGNGGFLVIKRPWPAMIRNIWGDPERFKKSYFPPELRGYYLAGDGAQRDA
DGYFWIMGRIDDVLNVSGHRLGTMEVESALVAHEMVAEAAVVGRPDDTTGEAVVAFVVLK
RSRPEGDEAQAIARQLRDWVGKEIGPIAKPKDIRFGDNLPKTRSGKIMRRLLRVVAKGEE
ITQDVSTLENPAILEQLAKPL
NT seq 2046 nt NT seq  +upstreamnt  +downstreamnt
gtggcgatacggttgcgtgtcggcaagaaaaacggcagcaccagaatcattcatcggaga
cacaccatgtcgaatgccattcaatccgtcctggtcgagaatcgcgtattcccgccgccg
gcgagcgccgtgcaaggcgccgcgatttcgggcatggacgcctattgggccctgtgcgag
gaagcggacaaggatttcaacgggttctggtcgcgcctggcgcgcgagaacctgcaatgg
agcaagcccttcactcaggtcctggacgagtccgaggcgcctttctatcggtggttcggc
gatggcgaactcaacgtatcggccaactgcctggacgtgcacctgcataacggcaacgcc
gacaagaccgccatcatcttcgaatccgacgacggcaaggtcgacaagatcagctaccgc
gaactgctggcgcgcgtgtgccgcttcgccaatggcctgaaggccatggggtacaagaag
ggcgaccgcgccatcatctacatgcccatgtcgatcgaggcggtggtggccatgcaggcc
tgcgcccgcctgggcgtgacccactcggtggtgttcggcggcttctcggccaagagcctg
caggagcgtatcgtcgacgtcggcgccacggtggtgatcaccgccgacgagcaggtgcgc
ggcggcaagaccatcccgctcaagcccgccgtcgaggaagcgttcgccatgggcggttgc
gaggccgtttccaaggtggtggtgtatcgccgcaccggcggcaagatcgcctggcaggaa
gggcgcgatgtctggatgcacgacgtggaagccggccaggccgatacctgcgagccgcag
gcggtcaatgccgagcatccgttgttcatcctgtacacgtcgggctccaccggcaagccc
aagggcgtgcagcatgcctccgcgggctatctgctgtgggcgctgctgaccatgaagtgg
accttcgacgcccgcgccgatgatgtgtactggtgcacggccgacgtgggctgggtgacc
ggccatacctatatcacctacggcccgctggccgccggcgtgacgcaggtggtgttcgag
ggcgtgcccacgttccccaatgccggacgcttctgggacatgattgcgcgccacaaggtg
tcggtgttctataccgcgccgaccgcgatccgctcgctcatcaaggccgccgaggccaac
caggaggtgcacccgcgccaatacgacctggacagcctgcgcatcatcggttcggtgggc
gagcccatcaaccccgaggcctggatctggtaccacaagaacgtcggccgcgagcgctgc
ccggtcgtcgacacctggtggcagaccgagaccggcgggcacatgctcacgccgctgccg
ggcgccacgccgctcaagccgggatcgtgcacgctgccgctgccgggcattgtcgcggca
atcgtcgacgagaccggcggcgatgtcgcgcagggcaatggcggcttcctggtcatcaag
cgtccctggccggccatgatccgcaacatctggggcgacccggagcggttcaagaagagc
tacttcccgcccgaactgcgcggctactacctggccggcgacggcgcccagcgcgacgcc
gatggctatttctggatcatggggcgcatcgacgacgtgctcaacgtgtccggccaccgc
ctcggcaccatggaggtggagtcggcgctggtggcgcacgaaatggtggccgaggccgcc
gtggtgggccgtcccgacgacaccaccggcgaagccgtggtggccttcgtggtgctcaag
cgcagccgtcccgagggcgacgaagcccaggccatcgccaggcaactgcgcgactgggtg
ggcaaggaaatcggccccatcgccaagcccaaggacatccgtttcggcgacaacctgccc
aagacccgttcgggcaagatcatgcgccgcctgctgcgcgtggtcgccaagggcgaggaa
atcacccaggacgtgtccaccctggagaaccccgccatcctcgagcaactggccaagccg
ttgtga

DBGET integrated database retrieval system