KEGG   Bordetella bronchiseptica RB50: BB3742Help
Entry
BB3742            CDS       T00141                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
bbr  Bordetella bronchiseptica RB50
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:bbr01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:bbr00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:bbr00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
3966026..3967126
Genome map
AA seq 366 aa AA seqDB search
MLMNPSLSRLRCLRCSHAVPPGDYPEGCPRCLAAGYPASLACEYEPADTQPMPLPVLAPI
TLGEGRTPCLDAPALAHAHGVAQVWLKCESGNPTGSHKDRMAAQLVSRAVLAGAKRLAAA
SSGNAGVALAAYGAAAGLRVDIAIAPTCPPRQRAAMEQFGARLHSFADSLARWPYVATLC
RDEGAFAGTNYLNPPVGTHPYGVEGYKPIAAELAAQCDNLPTDIIVPTARGDLLWGICLG
WQALLRRGAIARLPRLHAVEPYPRLAHALAAGDARGVWEQPTAQYSIAGGTVTLQSMQAL
ARSGGRAVDVADEQAARARAALGALGIAAELSSAAALAAVPALKAAGALDAGSRVALILT
SDGRRD
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgctgatgaacccctcgctgtcccgcctgcgctgcctgcgctgttcccacgccgtgccg
ccgggcgactacccggaaggctgcccgcgctgcctggcggccggctacccggcctcgctc
gcatgcgaatacgaaccggccgatacgcagccgatgccgctgccggtcctcgcgccgatc
acgctgggcgaaggccgcacgccctgcctcgacgcgccggcgctggcgcatgcgcacggg
gtggcgcaagtctggctgaaatgcgaaagcggcaacccgacgggcagccacaaggaccgc
atggctgcgcaactggtgtcgcgcgcggtgctggccggcgccaagcggctggcggccgcg
tccagcggcaacgccggcgtggcgctggcggcctacggggccgccgccggcctgcgggtg
gacatcgccattgcgcccacctgcccgccgcggcaacgcgccgccatggagcagttcggc
gcgcgcctgcacagcttcgccgacagcctggcgcgctggccctacgtggcgacgctatgc
cgcgacgagggcgcgttcgccggcaccaactatctcaacccgccggtcggcacccaccct
tacggcgtggagggctacaagccgatcgccgccgaactcgctgcccagtgcgacaacctg
cccaccgacatcatcgtgcccacggcccggggcgatctgctgtggggcatctgcctgggc
tggcaggcgctgttgcggcgcggcgcgatcgcgcggctgccgcgcctgcatgcggtggaa
ccctatccccgcctggcgcacgcgctggccgccggcgatgcgcgcggcgtgtgggaacag
ccgacggcgcagtattccatcgccggcggcaccgtgaccctgcaatcgatgcaggccctg
gcgcgcagcggcggacgggccgtggatgtcgcggacgagcaggccgcgcgggcccgcgcg
gcgctgggcgcgctgggcatcgccgccgagctgtcgtcggccgcggcgcttgccgccgtg
ccggcgctcaaggctgccggcgcgctggacgccgggtcgcgcgtggcgctgatcctgacc
tcggacgggcggcgcgactaa

DBGET integrated database retrieval system