KEGG   Bordetella bronchiseptica RB50: BB3773Help
Entry
BB3773            CDS       T00141                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
bbr  Bordetella bronchiseptica RB50
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bbr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BB3773 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BB3773 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BB3773 (trpA)
Enzymes [BR:bbr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BB3773 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
GeneDB: 
UniProt: 
Position
complement(3996279..3997136)
Genome map
AA seq 285 aa AA seqDB search
MTTTDRIAAAFARVSEAGRAAALIPYIAAGDPSPQATVPLMHALVRAGADLVELGVPFSD
PMADGPVVQRAAERAIAQGVGLRRVLELVADFRRDDSVTPVVLMGYANPIERMGQRAFAQ
AAQAAGVDGVLVVDYPPEEVDEFAAMLAEAGVAPIFLLAPTSTEARIEAIGRVARGYVYY
VSLKGVTGAGSLDTDDVARKLALIRRHVHIPVGVGFGIRDAASAQRIAAHADAVVIGSKL
IETMEQAGAQAGADQKNEAAIAAAQQWLHTIRLALDDVKRENAPA
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgactaccactgaccgaattgccgccgcgtttgcgcgggtttccgaggccggccgcgcg
gcggccctgatcccctacatcgccgccggcgacccgtcgccgcaggcgacggtaccgctg
atgcacgcgctggtgcgcgccggcgccgacctggtcgagctgggcgtgccgttctccgac
cccatggccgacggtccggtggtgcagcgcgccgccgagcgcgccatcgcccagggcgtc
gggctgcgccgcgtgctggagctggtggccgacttccgccgggacgacagcgtcacgccg
gtagtgctgatgggctatgccaatccgatcgaacgcatgggccagcgggcgtttgcgcag
gccgcgcaggcggccggcgtcgacggcgtgctggtggtcgactatccgcccgaagaggtc
gacgagttcgcggccatgctggccgaagccggcgtggcgccgatcttcctgctggcgccc
acctccaccgaggcccgcatcgaggcgatcggccgcgtggcgcgcggctacgtctattat
gtgtcgctcaagggcgtcacgggcgcgggcagcctggatacggacgacgtcgcgcgcaag
ctggcgctgattcgccgccacgtgcacattccggtgggcgtgggcttcggcatccgcgac
gcggccagcgcgcagcgcatcgccgcgcacgccgacgccgtggtcatcggcagcaagctg
atcgagaccatggagcaggccggcgcccaggccggcgcggaccagaaaaacgaggctgcc
atcgcggcggcgcagcaatggctgcacaccatccggctggcgctggatgacgtcaaacga
gaaaacgcgccggcctga

DBGET integrated database retrieval system