KEGG   Bordetella bronchiseptica RB50: BB3774Help
Entry
BB3774            CDS       T00141                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bbr  Bordetella bronchiseptica RB50
Pathway
bbr00260  Glycine, serine and threonine metabolism
bbr00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bbr01100  Metabolic pathways
bbr01110  Biosynthesis of secondary metabolites
bbr01130  Biosynthesis of antibiotics
bbr01230  Biosynthesis of amino acids
Module
bbr_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bbr00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BB3774 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BB3774 (trpB)
Enzymes [BR:bbr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BB3774 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: CAE35748
GeneDB: BB3774
UniProt: Q7WD04
Position
complement(3997140..3998339)
Genome map
AA seq 399 aa AA seqDB search
MKPYDLPDARGHFGPYGGVFVAETLMHALDELRAAYDQCRVDPSFIDEFNYELKHFVGRP
SPVYHASRWSQRLGGAQIWFKREDLNHTGAHKVNNCIGQALLARRMGKPRVIAETGAGQH
GVATATVAARYGMECVVFMGSEDVRRQASNVYRMKLLGATVVPVDSGSRTLKDALNEAMR
DWVTNIENTFYIIGTVAGPDPYPRMVRDFQTVIGQECLTQMPEVIGRQPDYVVAAVGGGS
NAMGIFHPYIPYENVRLIGVEAAGEGMETGRHAASLAAGQIGVLHGNRTYVMQNADGQVQ
ETHSVSAGLDYPGVGPEHAWLKDSGRAEYAGITDDEALAAFHDCCRIEGIMPALESAHAI
AQAVKMAPALSKDKVILVNLSGRGDKDMHTVAERAGLQL
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaccttacgaccttccggatgcccggggccatttcggcccctatggcggtgtgttt
gtggcggaaacgctgatgcacgccctagacgagctgcgcgcggcctatgaccagtgccgc
gtcgatcccagcttcatcgacgagttcaattacgagctcaagcatttcgtcggccggccc
agcccggtctaccacgccagccgctggtcgcagcgcctgggcggcgcgcagatctggttc
aagcgcgaagacctcaaccatacgggcgcgcacaaggtcaacaattgcatcggccaggcg
ctgctggcgcggcgcatgggcaagccgcgcgtcatcgccgagaccggcgccggccagcac
ggcgtggccacggccacggtagcggcccgctatggcatggaatgcgtggtgttcatgggc
agcgaggacgtgcgtcgccaggcctccaacgtctatcgcatgaagctgctgggcgccacg
gtggtgccggtggactcgggctcgcgcaccctgaaggacgcgctgaacgaagccatgcgc
gactgggtcaccaacatcgagaatacgttctacatcatcggcacggtggccgggcccgac
ccctacccgcgcatggtgcgcgacttccagaccgtcatcggccaggagtgcctgacccag
atgcccgaagtcatcggccgccagcccgactatgtggtcgcggcggtgggcggcggctcc
aacgccatgggcattttccatccctatatcccgtacgagaacgtgcgcctgatcggcgtc
gaggcggcgggcgagggcatggaaaccggccgccatgcggcctcgctggcggcgggccag
atcggcgtgctgcacggcaaccgtacctatgtcatgcagaatgccgacggccaggtgcag
gaaacccattcggtgtcggccgggctggattatcccggcgtggggccggagcatgcgtgg
ctcaaggacagcggccgcgccgagtacgcgggcatcaccgacgacgaggcgctggcggcg
ttccacgattgctgccgcatcgagggcatcatgccggcgctggagtccgcgcacgccatt
gcgcaggccgtgaaaatggcgcccgcgctttccaaggacaaggtcatcctggtcaatctg
tccggccggggcgacaaagacatgcacaccgtggccgagcgcgcgggccttcagctctga

DBGET integrated database retrieval system