KEGG   Bordetella bronchiseptica RB50: BB3876Help
Entry
BB3876            CDS       T00141                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bbr  Bordetella bronchiseptica RB50
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bbr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BB3876 (tpiA)
   01230 Biosynthesis of amino acids
    BB3876 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BB3876 (tpiA)
   00051 Fructose and mannose metabolism
    BB3876 (tpiA)
   00562 Inositol phosphate metabolism
    BB3876 (tpiA)
Enzymes [BR:bbr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     BB3876 (tpiA)
Exosome [BR:bbr04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BB3876 (tpiA)
  Exosomal proteins of bladder cancer cells
   BB3876 (tpiA)
  Exosomal proteins of melanoma cells
   BB3876 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
complement(4115177..4115923)
Genome map
AA seq 248 aa AA seqDB search
MTTAENRARLVLGNWKMHGNLAENAALLAELRAADAAAHCEMGVCVPFPYLAQTAAALQG
SAIGWGAQDVSAHAKGAYTGEVAAPMLAEFGCRWVLVGHSERRTLHAESDQLVADKARAA
LEAGLTPVVCVGESLQEREGGNTLGVIERQLEPVLALGRDALVRMVLAYEPVWAIGTGRT
ASPEQAQEVHSAIRVALDGLQASQVRVLYGGSVKGANAASLFAMPDIDGGLVGGASLVAE
EFLRIAAA
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgaccacagctgagaatcgcgcccgcctggtgctgggcaactggaagatgcacggcaac
ctggccgagaacgccgccttgctggccgagttgcgcgccgccgatgccgccgcccattgc
gaaatgggggtgtgcgtgccgtttccgtacctggcccagaccgctgccgccttgcagggc
agcgccatcggctggggcgcgcaggatgtcagcgcgcacgccaagggcgcctacaccggc
gaagtcgccgcccccatgctggccgaattcggctgccgctgggtgctggtgggccactcc
gagcggcgcacgctgcatgccgagagcgaccagctggtggccgacaaggcccgcgccgcg
ctcgaggcaggcctgaccccggtggtttgcgtcggcgaatcgctgcaagagcgcgaaggc
ggcaacaccctgggcgtgatcgagcgccagctcgaacccgtcctggccctgggccgcgat
gccctggtccgcatggtcctcgcctacgaacccgtctgggccatcggcaccggccgtact
gccagccccgagcaggcgcaggaagtgcacagcgccatccgcgtggcgctcgacggcctg
caagccagccaggtgcgcgtgctgtacggcggcagcgtcaagggggccaacgccgccagc
ctgttcgccatgcccgacatcgacggcggcctggtgggcggggcctcgctcgtcgctgaa
gaattcctgcgcatcgccgcagcttaa

DBGET integrated database retrieval system