KEGG   Bordetella bronchiseptica RB50: BB3876Help
Entry
BB3876            CDS       T00141                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bbr  Bordetella bronchiseptica RB50
Pathway
bbr00010  Glycolysis / Gluconeogenesis
bbr00051  Fructose and mannose metabolism
bbr00562  Inositol phosphate metabolism
bbr01100  Metabolic pathways
bbr01110  Biosynthesis of secondary metabolites
bbr01120  Microbial metabolism in diverse environments
bbr01130  Biosynthesis of antibiotics
bbr01200  Carbon metabolism
bbr01230  Biosynthesis of amino acids
Module
bbr_M00002  Glycolysis, core module involving three-carbon compounds
bbr_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bbr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BB3876 (tpiA)
   00051 Fructose and mannose metabolism
    BB3876 (tpiA)
   00562 Inositol phosphate metabolism
    BB3876 (tpiA)
Enzymes [BR:bbr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     BB3876 (tpiA)
Exosome [BR:bbr04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BB3876 (tpiA)
  Exosomal proteins of bladder cancer cells
   BB3876 (tpiA)
  Exosomal proteins of melanoma cells
   BB3876 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: CAE35850
GeneDB: BB3876
UniProt: Q7WCQ5
Position
complement(4115177..4115923)
Genome map
AA seq 248 aa AA seqDB search
MTTAENRARLVLGNWKMHGNLAENAALLAELRAADAAAHCEMGVCVPFPYLAQTAAALQG
SAIGWGAQDVSAHAKGAYTGEVAAPMLAEFGCRWVLVGHSERRTLHAESDQLVADKARAA
LEAGLTPVVCVGESLQEREGGNTLGVIERQLEPVLALGRDALVRMVLAYEPVWAIGTGRT
ASPEQAQEVHSAIRVALDGLQASQVRVLYGGSVKGANAASLFAMPDIDGGLVGGASLVAE
EFLRIAAA
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgaccacagctgagaatcgcgcccgcctggtgctgggcaactggaagatgcacggcaac
ctggccgagaacgccgccttgctggccgagttgcgcgccgccgatgccgccgcccattgc
gaaatgggggtgtgcgtgccgtttccgtacctggcccagaccgctgccgccttgcagggc
agcgccatcggctggggcgcgcaggatgtcagcgcgcacgccaagggcgcctacaccggc
gaagtcgccgcccccatgctggccgaattcggctgccgctgggtgctggtgggccactcc
gagcggcgcacgctgcatgccgagagcgaccagctggtggccgacaaggcccgcgccgcg
ctcgaggcaggcctgaccccggtggtttgcgtcggcgaatcgctgcaagagcgcgaaggc
ggcaacaccctgggcgtgatcgagcgccagctcgaacccgtcctggccctgggccgcgat
gccctggtccgcatggtcctcgcctacgaacccgtctgggccatcggcaccggccgtact
gccagccccgagcaggcgcaggaagtgcacagcgccatccgcgtggcgctcgacggcctg
caagccagccaggtgcgcgtgctgtacggcggcagcgtcaagggggccaacgccgccagc
ctgttcgccatgcccgacatcgacggcggcctggtgggcggggcctcgctcgtcgctgaa
gaattcctgcgcatcgccgcagcttaa

DBGET integrated database retrieval system