KEGG   Bordetella bronchiseptica RB50: BB3991Help
Entry
BB3991            CDS       T00141                                 

Definition
UTP--glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bbr  Bordetella bronchiseptica RB50
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:bbr00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:bbr00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:bbr00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:bbr00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
4240394..4241233
Genome map
AA seq 279 aa AA seqDB search
MQVVRKAVFPVAGMGTRFLPATKAMPKEMLPVVDKPLIQYAVEEAVAAGITDLIFVTGRN
KRAIEDHFDAAPELETDLEAKGKHELLALVRDILPAHVNCLYIRQSAPLGLGHAVLTAAP
AVGNEPFAVLLADDLIDADTPVLKQLIDVAVARQGSVLGVQEVPREDTRKYGIVASQPVD
ARTERVTHIVEKPAPEQAPTTLAVVGRYVLEAAIFDHLRATTVGAGNEIQLTDGIAALLR
ERDVYAHRYDGKRYDCGSKAGMFQATVALGRKYHGLIPE
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgcaagttgtccgcaaagccgtctttcccgtggccggtatgggcacccgttttctgccc
gccaccaaggccatgccgaaggaaatgctgccggtcgtggacaaacccctgatccaatat
gccgtcgaagaggccgtcgccgctgggatcaccgacctcatcttcgtcacgggccgcaac
aagcgggccatcgaagaccatttcgatgccgcccccgagctggaaaccgacctggaagcg
aagggcaagcacgaactgctggcgctggtccgcgacatcctccccgcgcacgtgaactgc
ctgtacatccgccaatcggccccgctgggcctgggacatgccgtgctgacggccgcgccg
gcggtaggcaacgagcccttcgcggtgctgctggccgatgacctgatcgacgccgacacg
ccggtgctcaagcagctgatcgacgtggcggtggcgcgccagggcagcgtgctgggcgta
caggaggtgccgcgcgaagacacgcgcaaatacggcatcgtggccagccagccagtcgat
gcgcgcaccgagcgtgtcacccacatcgtcgagaaacccgcccccgagcaagcccccacc
accctggcggtcgtcggccgctatgtgctggaggcagccattttcgaccatctgcgtgcc
accacggtcggggcgggcaatgaaatccagctgacggacggtatcgccgcgctgctgcgc
gaacgcgacgtctatgcgcaccgctatgacggcaagcgctatgactgcggcagcaaggcg
ggcatgttccaggccaccgtggccctgggccgcaaataccacggcctgattccggaataa

DBGET integrated database retrieval system