KEGG   Bordetella bronchiseptica RB50: BB3991Help
Entry
BB3991            CDS       T00141                                 

Definition
UTP--glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bbr  Bordetella bronchiseptica RB50
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bbr00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BB3991
   00052 Galactose metabolism
    BB3991
   00500 Starch and sucrose metabolism
    BB3991
   00520 Amino sugar and nucleotide sugar metabolism
    BB3991
Enzymes [BR:bbr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     BB3991
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
4240394..4241233
Genome map
AA seq 279 aa AA seqDB search
MQVVRKAVFPVAGMGTRFLPATKAMPKEMLPVVDKPLIQYAVEEAVAAGITDLIFVTGRN
KRAIEDHFDAAPELETDLEAKGKHELLALVRDILPAHVNCLYIRQSAPLGLGHAVLTAAP
AVGNEPFAVLLADDLIDADTPVLKQLIDVAVARQGSVLGVQEVPREDTRKYGIVASQPVD
ARTERVTHIVEKPAPEQAPTTLAVVGRYVLEAAIFDHLRATTVGAGNEIQLTDGIAALLR
ERDVYAHRYDGKRYDCGSKAGMFQATVALGRKYHGLIPE
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgcaagttgtccgcaaagccgtctttcccgtggccggtatgggcacccgttttctgccc
gccaccaaggccatgccgaaggaaatgctgccggtcgtggacaaacccctgatccaatat
gccgtcgaagaggccgtcgccgctgggatcaccgacctcatcttcgtcacgggccgcaac
aagcgggccatcgaagaccatttcgatgccgcccccgagctggaaaccgacctggaagcg
aagggcaagcacgaactgctggcgctggtccgcgacatcctccccgcgcacgtgaactgc
ctgtacatccgccaatcggccccgctgggcctgggacatgccgtgctgacggccgcgccg
gcggtaggcaacgagcccttcgcggtgctgctggccgatgacctgatcgacgccgacacg
ccggtgctcaagcagctgatcgacgtggcggtggcgcgccagggcagcgtgctgggcgta
caggaggtgccgcgcgaagacacgcgcaaatacggcatcgtggccagccagccagtcgat
gcgcgcaccgagcgtgtcacccacatcgtcgagaaacccgcccccgagcaagcccccacc
accctggcggtcgtcggccgctatgtgctggaggcagccattttcgaccatctgcgtgcc
accacggtcggggcgggcaatgaaatccagctgacggacggtatcgccgcgctgctgcgc
gaacgcgacgtctatgcgcaccgctatgacggcaagcgctatgactgcggcagcaaggcg
ggcatgttccaggccaccgtggccctgggccgcaaataccacggcctgattccggaataa

DBGET integrated database retrieval system