KEGG   Bordetella bronchiseptica RB50: BB4003Help
Entry
BB4003            CDS       T00141                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
bbr  Bordetella bronchiseptica RB50
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:bbr03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
4252374..4252946
Genome map
AA seq 190 aa AA seqDB search
MIGRITGTLIEKSPPVVCVDVNGVGYEIDVPMSTLYALPETGARVTLFTHLVVREDAQLL
YGFGSSAERSTFRELIKVTGIGARTALAVLSGLSVAELSQAITLQETGRLTRVPGIGKKT
AERLLLEMRGKLGADIGATPHAASGHQSDILNALLALGYSDKESQAALKKLPDGVDVSEG
IRLALKALVR
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgatcggacgcattaccggaaccctcatcgagaaatcgccgcccgtcgtctgtgtcgac
gtcaacggagtgggctatgaaatcgatgtccccatgagcaccctgtatgcgctgcccgag
accggcgcgcgggtcaccctgttcacccacctggtggtgcgcgaggatgcgcagctgctg
tacgggttcggcagcagcgccgagcgcagcacgttccgcgagctgatcaaggtgaccggc
atcggcgcacgcaccgcgctggcggtcctgtcggggctctcggtggccgagctgtcgcag
gccatcacgctgcaggagaccgggcgcctgacgcgcgtgccgggcatcggcaagaagacc
gcggagcgcctgctgctggagatgcgcggcaagctgggcgcggacatcggcgcgaccccg
cacgcggccagcggccaccagagcgatatcctcaacgcgctgctggcgctgggctactcc
gacaaggaatcccaggcggcgctcaagaagctgcccgacggggtggacgtgtcggaaggc
atccgcctggcgctcaaggccctggtccgctag

DBGET integrated database retrieval system