KEGG   Bordetella bronchiseptica RB50: BB4003Help
Entry
BB4003            CDS       T00141                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
bbr  Bordetella bronchiseptica RB50
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bbr00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BB4003 (ruvA)
Enzymes [BR:bbr01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     BB4003 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
4252374..4252946
Genome map
AA seq 190 aa AA seqDB search
MIGRITGTLIEKSPPVVCVDVNGVGYEIDVPMSTLYALPETGARVTLFTHLVVREDAQLL
YGFGSSAERSTFRELIKVTGIGARTALAVLSGLSVAELSQAITLQETGRLTRVPGIGKKT
AERLLLEMRGKLGADIGATPHAASGHQSDILNALLALGYSDKESQAALKKLPDGVDVSEG
IRLALKALVR
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgatcggacgcattaccggaaccctcatcgagaaatcgccgcccgtcgtctgtgtcgac
gtcaacggagtgggctatgaaatcgatgtccccatgagcaccctgtatgcgctgcccgag
accggcgcgcgggtcaccctgttcacccacctggtggtgcgcgaggatgcgcagctgctg
tacgggttcggcagcagcgccgagcgcagcacgttccgcgagctgatcaaggtgaccggc
atcggcgcacgcaccgcgctggcggtcctgtcggggctctcggtggccgagctgtcgcag
gccatcacgctgcaggagaccgggcgcctgacgcgcgtgccgggcatcggcaagaagacc
gcggagcgcctgctgctggagatgcgcggcaagctgggcgcggacatcggcgcgaccccg
cacgcggccagcggccaccagagcgatatcctcaacgcgctgctggcgctgggctactcc
gacaaggaatcccaggcggcgctcaagaagctgcccgacggggtggacgtgtcggaaggc
atccgcctggcgctcaaggccctggtccgctag

DBGET integrated database retrieval system