KEGG   Bordetella bronchiseptica RB50: BB4073Help
Entry
BB4073            CDS       T00141                                 

Definition
beta-D-hydroxybutyrate dehydrogenase (EC:1.1.1.30)
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
bbr  Bordetella bronchiseptica RB50
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:bbr00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:bbr00072]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
4331984..4332781
Genome map
AA seq 265 aa AA seqDB search
MNPARPLHGRCALITGAEAGLGLAIADTLARSGADIVMHCLQANESARQAQAALAREHGV
RVLLLQADLRDVDQIEAMAAQALAELPRLDILVNNAVVRHFEPAHELPRAHWDESLAVNL
SAAFHLARLALPGMLAQGWGRIINLSSVYGAGAAANRVGYVTTKTALLGLTRALAVETAA
SGITCNAVAPGTAPTPAIVGRIAEIARRDGVAQEQAEREYLAARQPTGRFVAMENVAALV
AFLCSDAGRDITGATLPIDGGWTAA
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgaacccggcccgcccgctacacgggcgctgcgccctgatcaccggcgccgaggccgga
ctggggctggccatcgccgatacgctggcccgttccggcgccgacatcgtgatgcactgc
ctgcaggccaacgaaagcgcccgccaggcgcaagccgccctggcgcgcgagcacggcgtg
cgggtgctgctgctgcaggccgacctgcgggacgtggaccagatcgaggccatggcggcc
caggcgctggccgagctgccgcgcctggacatcctggtcaacaacgccgtggtgcgccat
ttcgagccggcccatgaactgccgcgcgcccactgggacgagtcgctggccgtcaacctg
tcggcggcgttccacctcgcccgcctggcgctgccgggcatgctggcgcagggctggggc
cgcatcatcaatctgtcgtcggtctatggcgcgggagccgcggccaaccgggtcggctac
gtcaccaccaagaccgccctgctgggactgacccgcgcgctggccgtggaaaccgccgcc
agcggcatcacctgcaacgccgtcgcgccgggaaccgcgcccacgccggccatcgtcggc
cgcatcgccgagatcgcgcggcgcgacggcgtcgcgcaggaacaggccgaacgcgaatac
ctggccgcgcgccaacccaccggccgcttcgtcgccatggaaaacgtggcggccctggtc
gccttcctgtgcagcgatgccggacgcgacatcacgggcgccaccctgcccatcgacggc
ggctggaccgcggcctag

DBGET integrated database retrieval system