KEGG   Bordetella bronchiseptica RB50: BB4202Help
Entry
BB4202            CDS       T00141                                 

Gene name
murE
Definition
bifunctional UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase/UDP-N-acetylmuramoyl-tripeptide:D-alanyl-D-alanine ligase
Orthology
K15792  
murE/murF fusion protein [EC:6.3.2.13 6.3.2.10]
Organism
bbr  Bordetella bronchiseptica RB50
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:bbr00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:bbr00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
complement(4467778..4470615)
Genome map
AA seq 945 aa AA seqDB search
MSPTNRLNAVQRQHLDQALAWLRGCVAPTADLRLDSREIEPGDVFVACPGLASDGRQFMD
QALARGASAILYETEGAPVAPAGAQALPVAQLRTLLGALADEWYGRPSQDLSVVAITGTN
GKTSCTQWLAQVLTRMGKPCGSIGTLGALLPDGQSLGGSLTTPDVLTMHRTLARMRAAGA
RAVALEASSIGIEQGRLDHIRIAVAGFTNLTRDHLDYHGTMQRYEQAKAALFQWPDLQAA
VVNADDPAGERLLASLPAALKTGYSLQGAPADVHARDLQATAHGQVFTLALPDGEAQIVT
RLLGQHNISNLLLVAGALSKLGWPLPQIARELAAISPVDGRLQAVTPVPLQHLTAGAQGA
LVVVDYAHTPDALARALTALRPVAQARGGRLVCVFGCGGERDPGKRPEMGRIAVERADRV
VVTSDNPRSESPQDIIDQILAGIPAGMRAAVQPDRALAIMQTLWSAAPDDVILLAGKGHE
TYQDIGGRKLPFDDRQWARLALLLPHAGAVSTDTRRIGRGELFVALSGENFDGHDYLPQA
QSAGACAAVVAHPVADVALPQLVLGDTLAALGRMGTAWRSSFTLPVVAVTGSNGKTTTKE
MISAILAQWQGDDGRLATAGNFNNEIGVPLTLLRLRARHRAAVFELGMNHPGEIERLAAM
AAPTVALVTNAQREHQEFMHTVEAVAHENGAVISALPEDGVAVYPGDEPYAAIWDKLAGA
RRVLRFGLQPGLDVYAERVVTQAHGTQCGLVTPAGSAELDLPVPGLHNLRNALAAIACGL
AAGAPLHTCIAALAGFQAVAGRMQHRQMSDGTVLIDDTYNANPDSARAAIDVLARLPAPR
ALVLGDMGEVGDNGPAMHREVGDYAREHGIDALITLGEASRDAAHAFGPAARACASVDEV
VAALRGLRPSSILIKGSRFMRMERVVTAFSGNNQAPSGQGDKHAA
NT seq 2838 nt NT seq  +upstreamnt  +downstreamnt
atgagcccgacgaatcgcctgaacgccgtgcaacggcagcacctggaccaggcgctggcg
tggctgcgcggatgcgtcgccccgacggccgatctgcgcctggattcgcgcgagatcgag
ccgggcgatgtgttcgtcgcctgccccggcctggccagcgacggccgccaattcatggat
caggcgctggcgcgtggcgccagcgccatcctgtacgaaaccgaaggcgcgccggtcgcg
cccgcgggcgcgcaggccttgccggtcgcgcagctgcgcaccttgcttggcgcgctggcc
gatgaatggtatggccgtccgtcgcaggacctgagcgtggtggcgataaccggcaccaac
ggcaagacctcgtgcacccaatggctggcgcaggtgctcacgcgcatgggcaagccgtgc
ggcagcatcggcaccctgggcgcgctgctgcccgacggccagtcgctgggcggcagcctg
accacgccggatgtgctgaccatgcaccgcacgctggcccggatgcgcgccgcgggcgcg
cgcgcggtggccctggaggcctcgtccatcggcatcgagcagggccggctggaccatatc
cgcatcgcggtggcgggttttaccaacctgacgcgcgatcatctcgattaccacggcacc
atgcagcgctacgagcaggccaaggcggcgctgttccaatggccggacctgcaggccgcc
gtcgtcaatgcggacgatcccgccggcgaacgcttgctggcgtccctgccggccgcgctg
aagaccggctactcgctgcaaggggctcccgccgacgtccacgcgcgcgacctgcaggcc
accgcgcatggccaggtgttcacgctggcgctgcccgatggcgaagcgcagatcgtcacg
cgcctgctcggccagcacaatatctccaatctgctgttggtggccggcgcgctgagcaag
ctgggctggccgctgccgcagatcgcgcgcgaactggcggcgatttcgccggtcgacggc
cgcctgcaggccgtgacgccggtgccgttgcagcacctgaccgcgggcgcccaaggggcg
ctggtggtggtcgattacgcccatacgcccgacgccctggcgcgcgcgctgaccgccttg
cgcccggtggcgcaggcgcgcggcgggcgcctggtgtgcgtgttcggctgcggcggcgag
cgcgaccccggcaagcgacccgaaatgggccgtatcgccgtcgagcgggccgaccgggtg
gtggtcaccagcgacaatccgcgcagcgaatcgccgcaggacatcatcgaccagattctg
gccggcattcccgccggcatgcgcgcggcggtgcagcctgaccgcgcgctggccatcatg
cagacgctgtggagcgcggctcccgacgacgtgatactgctggccggcaagggacatgaa
acctaccaggacatcggcggccgcaaattgccgttcgacgatcgccagtgggcccggctg
gcgctgttgctgccgcatgcgggcgcggtgtcgaccgatacgcgccgcatcggccgcggc
gagctgttcgtggccctgtcgggcgaaaatttcgacggccacgactatctgccgcaggcg
cagtcggccggcgcctgcgccgccgtggtggcgcatcccgtggcggatgtggcgctgccc
cagctggtgctgggcgatacgctggccgcgctgggccgcatgggcacggcctggcgttcc
agtttcacgctgccggtcgtcgccgtgacgggcagcaatggcaagaccaccaccaaggaa
atgatttccgccatcctggcgcagtggcagggcgacgacggccgcctggcgacggctggc
aatttcaacaacgagatcggcgtgccgctgaccctgctgcgcctgcgcgcgcggcatcgc
gccgccgttttcgagctgggcatgaaccatcccggcgagatcgaacgcctggccgcgatg
gcggcgccgacggttgcgctggtgaccaatgcccagcgcgaacaccaggaattcatgcat
accgtcgaggcggtggcgcacgagaacggcgcggtcatcagcgccttgccggaggacggc
gtggccgtctatccgggcgacgaaccctacgctgccatctgggacaagctggcgggcgcg
cgccgggtgctgcgcttcggcctgcaaccgggcctggatgtctacgccgagcgtgtcgtg
acgcaggcgcatggcacgcaatgcggcctggtgaccccggccggcagcgccgagctggat
ctgcccgtgccgggcctgcacaacctgcgcaatgcgctggcggcgatcgcttgcggcctg
gcggccggcgcgcccctgcatacctgcatcgcggcgctggccggtttccaggccgtcgcc
gggcgcatgcagcatcggcaaatgagtgacggaaccgtgctcatcgatgacacctacaat
gccaatcctgactcggcgcgcgccgccatcgacgtgctggcgcggctgcccgcgccgcgc
gcattggtgctcggcgacatgggcgaagtcggggacaacgggcccgccatgcatcgcgag
gtgggcgattacgcgcgcgagcatggcatcgacgcgcttatcacgctaggcgaggccagc
cgggatgccgcacacgcattcggtccggcggcgcgcgcctgcgcatcggttgacgaagtc
gtggccgcgttgcgcggcctgcgcccgtccagcattttgatcaagggttcgcgctttatg
cgcatggagcgggtagtgacggctttcagcggcaacaatcaggcgccttcggggcagggg
gacaagcatgctgcttga

DBGET integrated database retrieval system