KEGG   Bordetella bronchiseptica RB50: BB4629Help
Entry
BB4629            CDS       T00141                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
bbr  Bordetella bronchiseptica RB50
Pathway
bbr00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bbr01100  Metabolic pathways
bbr01110  Biosynthesis of secondary metabolites
bbr01130  Biosynthesis of antibiotics
bbr01230  Biosynthesis of amino acids
Module
bbr_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bbr00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BB4629 (trpC)
Enzymes [BR:bbr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     BB4629 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C
Motif
Other DBs
NCBI-ProteinID: CAE34991
GeneDB: BB4629
UniProt: Q7WEK6
Position
4929133..4929921
Genome map
AA seq 262 aa AA seqDB search
MNDILAKILAVKAEEVATARQMRSEAELLREAQARQDVRGFAQAIEDKISQGKAGVIAEI
KKASPSKGVLRENFDPAEIAASYAMHGAACLSVLTDVQFFQGSHDNLRRARAACSLPVLR
KDFIIDPYQIISARAMGADCVLLIVAALAPAQLRDLETLAIDLGMDVLVEVHDAKELDAA
LALRTPLIGINNRNLRTFETTLQTTLDLLPMIPAGKRVVTESGILKPEDVRLMREHDVQA
FLVGEAFMRANDPGVELARLVA
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgaacgatattcttgcgaaaatcctcgccgtcaaggccgaggaagtggctaccgcacgg
cagatgcgcagcgaggctgaattgctgcgcgaagcccaggcgcgccaggatgtacgcggc
tttgcccaggccatcgaggacaagatcagccagggcaaggcgggcgtcatcgcggaaatc
aagaaagcctcgccttccaagggcgtgctgcgcgaaaacttcgacccggccgagatcgcg
gcgtcctatgccatgcatggcgcggcctgcctgtcggtgctgaccgacgtgcagttcttc
cagggctcgcacgacaacctgcgccgtgcgcgcgcggcctgctcgctgcccgtgctgcgc
aaggacttcatcatcgatccttaccagatcatttcggcgcgcgccatgggcgcggactgc
gtcctgctcatcgtcgcggcgctggcgccggcgcagctgcgcgatctggaaaccctggcc
atcgacctgggcatggacgtgctggtggaagtgcacgacgccaaggagctggacgccgcg
ctcgcgctgcgcaccccgctcatcggcatcaacaaccgcaacctgcgcaccttcgagacc
accctgcagacgacgctggacctgctgccgatgattccggccggcaagcgcgtggtcacc
gaaagcggcatcctcaagcccgaggatgtcaggctgatgcgcgagcacgacgtacaggcc
ttcctcgtcggcgaggccttcatgcgcgccaacgacccgggcgtcgaactggcgcggctg
gtggcctga

DBGET integrated database retrieval system