KEGG   Bordetella bronchiseptica RB50: BB4797Help
Entry
BB4797            CDS       T00141                                 

Definition
(GenBank) putative acetyl-CoA synthetase
Organism
bbr  Bordetella bronchiseptica RB50
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_5 Succ_CoA_lig CoA_binding_2 CoA_binding ATP-grasp_2 CPSase_L_D2 FdhD-NarQ
Motif
Other DBs
NCBI-ProteinID: CAE35160
GeneDB: BB4797
UniProt: A0A0H3LRL5
Position
complement(5103037..5105178)
Genome map
AA seq 713 aa AA seqDB search
MDNASVSPGFTRPPRLSVARIVAPGSIAVVGASDDLKKFGGRIIHYVTRNGYRGTVIPVN
PRRAEVAGLPAVPSIAHLGPVDVAILALPVDMIEQAIGECAAAGVGACVIVSAGFAELGD
EGVARQDRIVRIAREAGMRLVGPNCMGIINPHHRMALTSSLVVEQGELLPGNIGLISQSG
ALMVSMYDRACREQIRFSACVSLGNQCDLEICDFFEYMIDDPLTRVITMYVEGFVDTGRF
AELARRAQRAGKPVLLTKTGRTAAGAEAARSHTASLAGNYRALEALCEATGVTIVDDPDG
MLQLAAILARFGRCAAEGVGIVSPSGGAIGIGVDRLSDVGIRLGRLDAASQQLLGTVMNP
SHAFNPVDLGNRTTEEMSQLRTIVQAYNQAPDIGVIFVILTTSPHFEQVTLALGQAMAQA
GGKPVLFLVTPGGVADNCRTLLQDLGLPYVDRMDDAIRILRHYVPKADALPARDAPRPAS
WPMPEGAGRMLGARPGEPEVKALLRAYGIPLAQERFCRTAEQAVEAARAIGFPVVLKAVS
AQLVHKSDIGAVKLRLADDAAVRRAWAEIEQALSSQVDGAVLDGCLVAEMVTAQSELLVG
AINDAQFGPMIMVGFGGVTVELVPDTQLAVAPVDTEQAMALLRRLKQWPLLDGYRGMPKA
DVAAVAEVVSRVSWLIADLRDQVAELDINPLLIRAGDGKPIGVDARAAMLGPG
NT seq 2142 nt NT seq  +upstreamnt  +downstreamnt
atggacaacgcttccgtatcgcccggttttaccaggccgccccggttgagcgtggcgcgc
atcgtcgcgccgggttcgatcgccgtcgtgggggcctccgacgacctgaagaagttcggc
ggccgcatcatccactacgtcacgcgcaacggctaccgcggcaccgtgatacccgtcaac
ccgcgcagggccgaagtggcggggctgccggcggtgccgagcatcgcccacctgggtccg
gtggatgtcgccatcctcgcgctgccggtggacatgatcgagcaggccatcggcgaatgc
gccgcggcgggcgtgggcgcctgcgtgatcgtgtcggcggggttcgccgagctgggcgac
gaaggcgtcgcgcggcaggaccggatcgtgcgcattgcgcgcgaggcgggcatgcggctg
gtgggtccgaactgcatgggcatcatcaatccccaccatcgcatggcgttgacgtcctcg
ctggtggtggaacagggcgagctgctgccgggcaacatcggcctgatcagccagagcggc
gcgctcatggtgtcgatgtacgaccgggcatgccgcgagcagatccgcttcagcgcctgc
gtgtcgctgggcaaccagtgcgacctggagatctgcgacttcttcgagtacatgatcgac
gatccgctgacgcgcgtcatcacgatgtatgtcgagggtttcgtcgataccggccggttc
gccgagctggcgcgccgcgcgcagcgcgcgggcaagcccgtgctcctgaccaagaccggc
cgcaccgccgccggcgccgaggccgcgcgctcgcataccgccagcctggcgggcaactac
cgggcgctcgaagcgctgtgcgaagccacgggcgtgacgatcgtcgacgaccccgacggg
atgctgcagctggccgcgatcctggcgcgattcgggcgatgcgccgccgaaggcgtgggc
attgtttccccgtcgggcggcgccatcgggatcggggtcgaccgcctgtccgacgtgggc
atccggctgggcaggctggacgccgcgtcccagcagttgctgggcacggtgatgaacccc
agccatgccttcaatccggtggacctgggcaatcggaccacggaagagatgagccagctg
cgcaccatcgtgcaggcatacaaccaggcgcccgatatcggcgtcattttcgtcattctc
acgacttcgccgcacttcgagcaggtgacgctggcgctgggccaggccatggcgcaggcg
ggcggcaagccggtgctgttcctggtgacgcccgggggcgtggccgacaactgccggacc
ttgctgcaggatctgggcctgccttatgtcgatcgcatggatgatgcgatccgcatcctg
cggcactacgtgccgaaggccgacgccctgcccgcccgggacgcgccgcggcccgcgtcg
tggccgatgcccgagggcgccggccgcatgctgggcgcgcgtcccggcgaacccgaggtc
aaggcgctgctgcgcgcgtacgggatcccgctggcgcaagagcgtttctgccgcacggcc
gaacaagccgtcgaggccgcgcgggccatcggctttcccgtggtgctcaaggctgtcagc
gcgcaactcgtgcacaagagcgatatcggggcggtcaagctgaggctggcggacgacgcg
gccgtgcggcgcgcctgggcggagatcgaacaggccctgtccagccaggtcgacggcgcc
gtgctcgatggctgcctggtggccgagatggtgaccgcgcaaagcgagctgctggttggc
gcgatcaacgacgcccagttcggcccgatgatcatggtcgggttcgggggggtcaccgtg
gagctggtgccggatacccagttggcggtggcgcccgtggacacggaacaggccatggcg
ctattgcggcggctcaagcaatggccgctgctcgatggctaccgaggcatgcccaaggcg
gatgtggcggccgtggccgaggtcgtcagccgggtcagctggctgatcgcggacttgcgc
gaccaggtggccgagctcgacatcaatccgttgctgatccgggccggggacggcaagccg
atcggcgtggatgcgcgggccgccatgctcggcccgggctga

DBGET integrated database retrieval system