KEGG   Bordetella bronchiseptica RB50: BB4797Help
Entry
BB4797            CDS       T00141                                 

Definition
acetyl-CoA synthetase (EC:6.2.1.13)
Orthology
K01905  
acetyl-CoA synthetase (ADP-forming) [EC:6.2.1.13]
Organism
bbr  Bordetella bronchiseptica RB50
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bbr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BB4797
   00620 Pyruvate metabolism
    BB4797
   00640 Propanoate metabolism
    BB4797
Enzymes [BR:bbr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.13  acetate---CoA ligase (ADP-forming)
     BB4797
Lipid biosynthesis proteins [BR:bbr01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   BB4797
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
complement(5103037..5105178)
Genome map
AA seq 713 aa AA seqDB search
MDNASVSPGFTRPPRLSVARIVAPGSIAVVGASDDLKKFGGRIIHYVTRNGYRGTVIPVN
PRRAEVAGLPAVPSIAHLGPVDVAILALPVDMIEQAIGECAAAGVGACVIVSAGFAELGD
EGVARQDRIVRIAREAGMRLVGPNCMGIINPHHRMALTSSLVVEQGELLPGNIGLISQSG
ALMVSMYDRACREQIRFSACVSLGNQCDLEICDFFEYMIDDPLTRVITMYVEGFVDTGRF
AELARRAQRAGKPVLLTKTGRTAAGAEAARSHTASLAGNYRALEALCEATGVTIVDDPDG
MLQLAAILARFGRCAAEGVGIVSPSGGAIGIGVDRLSDVGIRLGRLDAASQQLLGTVMNP
SHAFNPVDLGNRTTEEMSQLRTIVQAYNQAPDIGVIFVILTTSPHFEQVTLALGQAMAQA
GGKPVLFLVTPGGVADNCRTLLQDLGLPYVDRMDDAIRILRHYVPKADALPARDAPRPAS
WPMPEGAGRMLGARPGEPEVKALLRAYGIPLAQERFCRTAEQAVEAARAIGFPVVLKAVS
AQLVHKSDIGAVKLRLADDAAVRRAWAEIEQALSSQVDGAVLDGCLVAEMVTAQSELLVG
AINDAQFGPMIMVGFGGVTVELVPDTQLAVAPVDTEQAMALLRRLKQWPLLDGYRGMPKA
DVAAVAEVVSRVSWLIADLRDQVAELDINPLLIRAGDGKPIGVDARAAMLGPG
NT seq 2142 nt NT seq  +upstreamnt  +downstreamnt
atggacaacgcttccgtatcgcccggttttaccaggccgccccggttgagcgtggcgcgc
atcgtcgcgccgggttcgatcgccgtcgtgggggcctccgacgacctgaagaagttcggc
ggccgcatcatccactacgtcacgcgcaacggctaccgcggcaccgtgatacccgtcaac
ccgcgcagggccgaagtggcggggctgccggcggtgccgagcatcgcccacctgggtccg
gtggatgtcgccatcctcgcgctgccggtggacatgatcgagcaggccatcggcgaatgc
gccgcggcgggcgtgggcgcctgcgtgatcgtgtcggcggggttcgccgagctgggcgac
gaaggcgtcgcgcggcaggaccggatcgtgcgcattgcgcgcgaggcgggcatgcggctg
gtgggtccgaactgcatgggcatcatcaatccccaccatcgcatggcgttgacgtcctcg
ctggtggtggaacagggcgagctgctgccgggcaacatcggcctgatcagccagagcggc
gcgctcatggtgtcgatgtacgaccgggcatgccgcgagcagatccgcttcagcgcctgc
gtgtcgctgggcaaccagtgcgacctggagatctgcgacttcttcgagtacatgatcgac
gatccgctgacgcgcgtcatcacgatgtatgtcgagggtttcgtcgataccggccggttc
gccgagctggcgcgccgcgcgcagcgcgcgggcaagcccgtgctcctgaccaagaccggc
cgcaccgccgccggcgccgaggccgcgcgctcgcataccgccagcctggcgggcaactac
cgggcgctcgaagcgctgtgcgaagccacgggcgtgacgatcgtcgacgaccccgacggg
atgctgcagctggccgcgatcctggcgcgattcgggcgatgcgccgccgaaggcgtgggc
attgtttccccgtcgggcggcgccatcgggatcggggtcgaccgcctgtccgacgtgggc
atccggctgggcaggctggacgccgcgtcccagcagttgctgggcacggtgatgaacccc
agccatgccttcaatccggtggacctgggcaatcggaccacggaagagatgagccagctg
cgcaccatcgtgcaggcatacaaccaggcgcccgatatcggcgtcattttcgtcattctc
acgacttcgccgcacttcgagcaggtgacgctggcgctgggccaggccatggcgcaggcg
ggcggcaagccggtgctgttcctggtgacgcccgggggcgtggccgacaactgccggacc
ttgctgcaggatctgggcctgccttatgtcgatcgcatggatgatgcgatccgcatcctg
cggcactacgtgccgaaggccgacgccctgcccgcccgggacgcgccgcggcccgcgtcg
tggccgatgcccgagggcgccggccgcatgctgggcgcgcgtcccggcgaacccgaggtc
aaggcgctgctgcgcgcgtacgggatcccgctggcgcaagagcgtttctgccgcacggcc
gaacaagccgtcgaggccgcgcgggccatcggctttcccgtggtgctcaaggctgtcagc
gcgcaactcgtgcacaagagcgatatcggggcggtcaagctgaggctggcggacgacgcg
gccgtgcggcgcgcctgggcggagatcgaacaggccctgtccagccaggtcgacggcgcc
gtgctcgatggctgcctggtggccgagatggtgaccgcgcaaagcgagctgctggttggc
gcgatcaacgacgcccagttcggcccgatgatcatggtcgggttcgggggggtcaccgtg
gagctggtgccggatacccagttggcggtggcgcccgtggacacggaacaggccatggcg
ctattgcggcggctcaagcaatggccgctgctcgatggctaccgaggcatgcccaaggcg
gatgtggcggccgtggccgaggtcgtcagccgggtcagctggctgatcgcggacttgcgc
gaccaggtggccgagctcgacatcaatccgttgctgatccgggccggggacggcaagccg
atcggcgtggatgcgcgggccgccatgctcggcccgggctga

DBGET integrated database retrieval system