KEGG   Bifidobacterium breve JCM 7019: B7019_0043Help
Entry
B7019_0043        CDS       T03121                                 

Definition
Phosphoenolpyruvate carboxylase
Orthology
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
bbrc  Bifidobacterium breve JCM 7019
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bbrc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    B7019_0043
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    B7019_0043
  Energy metabolism
   00680 Methane metabolism
    B7019_0043
Enzymes [BR:bbrc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     B7019_0043
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
complement(55178..57931)
Genome map
AA seq 917 aa AA seqDB search
MATPEEQITPADAAIVTTGTGRKGPEEHDLPQNLKYDMDLCLKILRDVLGEYNPDLLSTF
DTVRNYAVEASAGHFSEVNNPNPSRDGLKEAVDVIDDMTLHDAQLLARAFATYFHLANLS
EENYRVSVLHERENNVSDDQAVDPINELTVAYHQLINEMGPAKAKELLDRLEFHPVFTAH
PTEARRKAVEGKIRRISELLEEYKSLGGLDKKESLRRLYNEIDALFRTSPIALKKPTPVE
EADTILDIFDNTLFNTIPAVYRRFDDWVLGDKAGLVEPACPAFFRPGSWIGSDRDGNPNV
TAKVSRQVARKFSDHVIAALEEVTRTVGRNLTMEAETTPPSADLKSLWSHQKEMSERLTD
KAALISNKELHRAVMLVMADRLHYTIERDADLMYHSCDDFIADLKVVQQSLATAGARRSA
YGPLQDLIWQAQTFGFHMVEMEFRQHSVVHARALADIREHGLHGERGDLQPMTHEVLDTF
RALGAIQKRNGLKAARRYIISFTKSAQNIKDVYELNRLAFSHPEDVPTIDVIPLFEQLED
LQNSVDVLEEMIKIPEVQARLKATGNKLEVMLGYSDSSKDAGPTSATLALHSAQERIAKW
AESHDIDLTLFHGRGGAVGRGGGPANRAVLAQPVGSVKCRFKLTEQGEVIFARYGNPVLA
IRHVESVAAATLLQSAPSVEKTNTEMTRKYADMAAQLDEAAHNRFLDLLGTDGFAPWFSI
VTPLTEIGLLPIGSRPAKRGLGAKSLDDLRTIPWIFSWAQARINLAAWYGLGTACEKFGD
LDTLRKAYEEWPLFSTFIDNIEMSIAKTDERIAKMYLALGDREDLNKKVLEEMELTRKWV
LAIVGDKWPLQHRHVLGQAIRIRSPYVDALSVTQVLALKSLRKKVDKEELSQSQQAGFIY
LILCTVSGVAAGLQNTG
NT seq 2754 nt NT seq  +upstreamnt  +downstreamnt
atggcaacaccagaagaacagatcactcctgctgacgccgccatcgtcaccaccggaacc
ggccgtaagggccccgaggagcatgatcttccccaaaacctcaagtacgacatggatctg
tgtttgaagatcctgcgtgacgtactgggcgaatacaatcccgatctgctttccacgttc
gacaccgtgcgcaattacgcagtggaggccagcgccgggcatttctccgaggtcaataat
ccgaacccctcacgggacggcttgaaagaggccgtggacgtcatcgacgatatgacgttg
cacgacgcccagttgctggcccgcgcgttcgccacgtatttccacctggcgaacctgtcc
gaggagaactaccgcgtctccgtgctgcatgagcgcgagaacaacgtgtccgacgaccag
gccgtcgatccgatcaacgaactcaccgtcgcctaccaccagctcatcaacgagatgggc
ccggccaaggccaaggagctgctcgaccggctcgagttccaccccgtgttcacggcgcac
cccaccgaggcccgccgcaaggccgtggaaggcaagattcgccgcatctccgaactgctc
gaggaatacaagagcctcggcggattggacaagaaggagagtctgcgccgtctctacaac
gaaatcgacgcgctgttccgcacctccccgatcgcgctgaagaaaccgaccccggtcgag
gaagcggacacgattctcgatatcttcgacaacaccctgttcaacacgattccggccgtc
taccgtcgcttcgacgactgggtgctgggcgacaaggccggcttggtggagcccgcgtgc
cccgcgttcttccgcccgggcagctggatcggctccgaccgcgacggcaacccgaacgtc
accgccaaggtgagccgtcaggtggcccgcaagttctccgatcatgtgatcgccgcactt
gaggaagtcacccgcacggtgggccgcaacctcaccatggaagccgagaccacgccgcca
agcgccgacctcaagagcctctggagccaccagaaggagatgagcgagcgtctgaccgac
aaggccgccctgatctccaacaaggaactgcaccgcgcggtcatgctggtgatggccgac
cgtctgcactacaccatcgaacgtgacgccgatctcatgtaccattcctgcgacgatttc
atcgccgacctcaaggtggtgcagcagtcgttggccaccgccggcgcgaggcgttccgcc
tacggcccgctgcaggaccttatctggcaggcgcagaccttcggcttccacatggtcgaa
atggagttccgtcagcactccgtggtgcatgcccgcgcccttgcggacatccgcgaacat
ggtctgcacggcgaacgcggcgatctgcagccgatgacccacgaggtgctcgacaccttc
cgcgcgctcggggccatccagaagcgcaacggcctcaaggccgcccgccgctacatcatc
tccttcaccaagagcgcccagaacatcaaggatgtctacgagctcaaccgtctggccttc
tcccatcccgaagacgtgcccaccatcgatgtgattccgctgttcgagcagctagaggat
ctgcagaactcggtggatgtgctcgaggaaatgatcaagatccccgaggtccaggctcgc
ctcaaggccaccggcaacaagctcgaggtcatgctcggctactccgattcctcgaaggac
gccggaccgacctccgccacgctggcgctgcactccgcccaggaacgcatcgccaagtgg
gccgaatcgcacgacatcgacctgacgctgttccatggccgcggcggcgccgtcggtcgc
ggcggcggcccggccaaccgtgcggtgctcgcccagccggtcggttccgtcaagtgccgc
ttcaagctcaccgaacagggcgaggtcattttcgcccgttacggcaacccggtgcttgcc
atccgccacgtggagtccgtagccgcggcgaccttgctgcagtccgccccgagcgtggag
aagaccaacaccgagatgacccggaagtacgccgacatggccgctcagctcgatgaggca
gcacataaccggttcctcgacttgctgggcaccgacggtttcgcgccgtggttctcgatc
gtcacgccgctgaccgagatcggcctgctgccgatcggctcccgcccggccaagcgtggc
ctgggcgccaagtccctcgacgatctgcgcaccatcccgtggatcttctcctgggctcag
gcacgcatcaacctggccgcttggtacggcctcggtaccgcatgcgagaagttcggcgat
ctggacacgctgcgcaaggcgtatgaggaatggccgctgttctccacgttcatcgacaac
atcgagatgtccatcgccaagacggacgagcgcatcgccaagatgtacctcgccctcggc
gaccgcgaggacctcaacaagaaggtgctcgaggagatggagctcacccgcaagtgggtg
ctcgccatcgtgggtgacaagtggccgctgcagcaccgccacgtgctcggccaggccatc
cgcattcgttcgccgtatgtggacgcgctgtccgtcacccaggtgctggcgctcaagtcg
ctacgcaagaaggtggacaaggaagagctctcgcaaagccagcaggcaggattcatctat
ctgatcctctgcaccgtttcaggtgttgctgccggcctgcagaacacgggctga

DBGET integrated database retrieval system