KEGG   Bifidobacterium breve JCM 7019: B7019_0849Help
Entry
B7019_0849        CDS       T03121                                 

Definition
O-Glycosyl hydrolases family 30, Glucosylceramidase
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
bbrc  Bifidobacterium breve JCM 7019
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bbrc00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    B7019_0849
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    B7019_0849
Enzymes [BR:bbrc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     B7019_0849
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
1026134..1027465
Genome map
AA seq 443 aa AA seqDB search
MGAKIFRTISQRHLMEPIEQASHEGTFDVEIMMKPGETMQRVVGFGASLTDSSAYLLNET
LDDESRKQAMTDLFDPDQGIGLSMLRNPMGASDYARDVYSYDDMPDGKRDDSMEHFSIAR
DERNVIPLIHEAKRLNPDLKVVMSPWSAPAWMKTNGSMKAGSLREDCRETYARYFVQCLR
AYGSHGIEVHAVTPQNEPLYEPTHYPSMAMSAQEETVFVRDHLRTAMREAGFKTLILGYD
HNWDRCDYPLALLDGAAESFDGIAWHWYAGDPQSQSVVSERHPGKLSYVTEASGGEWIPG
FEPAFSHLVGMIIQALNHGANAFVLWNIALDEHRGPTVPGFGESTCRGLLRVDSERRKAS
KEIDYYGLAHFSRHIRPGAHVVPTIATGNTDGARCVAALNEDGSRAMVLLNDGESPITVR
AGWEDNAANVTLTPKAVATIVWR
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgggagcgaagatcttccgcaccatttcccaaaggcatctcatggaacccatcgaacaa
gcctcgcacgaggggacgttcgacgtggagatcatgatgaaacccggggaaacgatgcag
cgcgtcgtcggcttcggcgcgtccctcacggactcctccgcgtatctgctcaacgagacg
ctggacgatgagagcagaaaacaagccatgacggacctcttcgacccggaccagggcatc
ggcctgtcgatgctccgcaatccgatgggcgcaagcgattacgccagggatgtctacagc
tacgacgacatgccggatgggaaacgggacgactcgatggagcatttctccatcgcgcga
gacgaacgcaacgtgatacccctgatccacgaggccaaacggctgaaccccgacctgaag
gtcgtgatgagcccatggagcgcccccgcatggatgaagaccaacggaagcatgaaggcg
ggaagcctcagggaagactgccgggaaacctacgccaggtatttcgtccagtgcttgcgc
gcctacgggtcccacggcatcgaagtacatgccgtcacgcctcagaatgagcccctgtac
gagcccacccattaccccagcatggcgatgagcgcacaggaggagaccgtcttcgtcagg
gaccatctcaggacggccatgcgcgaagcgggattcaagacgctgatactcggatacgac
cacaattgggacagatgcgactatccgctggcgttgcttgacggcgcggccgaatcgttc
gatggaatcgcatggcattggtacgcgggcgacccccaatcgcagagcgtcgtgtccgaa
cgccaccccgggaaactctcctatgtgaccgaagcgtcgggcggagaatggatccccggg
ttcgaaccggcgtttagccacctggttggcatgatcatccaggcactgaaccatggggcg
aatgcgttcgtcctatggaacatcgctttggacgagcatcgcggaccgacggtgcctgga
ttcggggaatccacatgcagggggctgctgcgcgtcgactccgaacgtcgcaaggcgagc
aaggagatcgactactacgggctggcgcatttcagccgtcacattcgtccgggggcccat
gtcgtccccaccatcgcaacgggaaacacggacggcgcgcgatgcgtggcggcgctcaac
gaagatggaagccgcgccatggttcttctgaacgatggggaatctccgataaccgtcagg
gcggggtgggaggataacgcggccaacgttacgctgacgcctaaagccgtcgctacgatc
gtatggaggtga

DBGET integrated database retrieval system