KEGG   Bifidobacterium breve 12L: B12L_0042Help
Entry
B12L_0042         CDS       T03118                                 

Definition
Phosphoenolpyruvate carboxylase
Orthology
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
bbre  Bifidobacterium breve 12L
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bbre00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    B12L_0042
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    B12L_0042
  Energy metabolism
   00680 Methane metabolism
    B12L_0042
Enzymes [BR:bbre01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     B12L_0042
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
complement(54652..57405)
Genome map
AA seq 917 aa AA seqDB search
MATPEEQITPADAAIVTTGTGRKGPEEHDLPQSLKDDMDLCLKILRDVLGEYNPELLSTF
DTVRNYSVEASAEHFAELEDPNPAQDGLKEAVNVIDNMTLHDAQLLARAFATYFHLANLS
EENYRVSVLHERENNVSGEQAVDPINELTVAYHQLINEMGPAKAKELLDQLEFHPVFTAH
PTEARRKAVEGKIRRISELLGEYKILGGSDKKECLRRLYNEIDALFRTSPIALKKPTPVE
EADTILDIFDNTLFHTIPKVYRRFDDWILGDQAGLVEPVCPAFFHPGSWIGSDRDGNPNV
TAKVSRAVARKFSDHVIAALEEATRTVGRNLTMEAETTPPSAELKNLWSHQKEMSERLTD
KAALISTKEMHRAVMLVMADRLHYTIERDADLMYHSCNDFLNDLKVVQRSLAEAGAKRSA
YGPLQDLIWQTETFGFHMVEMEFRQHSVVHARALADIREHGLHGERGELQPMTHEVLDTF
RALGAIQKRNGLKAARRYIISFTKSAQNIKDVYELNRLAFSHPEDVPTIDVIPLFEQLED
LQNSVDVLEEMIKIPEVQARLKATGNKLEVMLGYSDSSKDAGPTSATLALHSAQERIAKW
AESHDIDLTLFHGRGGAVGRGGGPANRAVLAQPVGSVKCRFKLTEQGEVIFARYGNPVLA
IRHVESVAAATLLQSAPSVEKRNTDMTKKYADMAAQLDEAAHNRFLDLLNTDGFAPWFSI
VTPLTEIGLLPIGSRPAKRGLGAKSLDDLRTIPWIFSWAQARINLAAWYGLGTACEKFGD
LETMRQAYEEWPLFSTFIDNIEMSIAKTDERIAKMYLALGDREDLNKKVLEEMELTRKWV
LDIVGDKWPLQHRHVLGQAIRIRSPYVDALSVTQVLALKSLRKKVDKEELSQSQQAGFIY
LILCTVSGVAAGLQNTG
NT seq 2754 nt NT seq  +upstreamnt  +downstreamnt
atggcaacaccagaagaacagatcactcctgctgacgccgccatcgtcactaccggaact
ggccgcaagggccccgaggagcatgatcttccccaaagcctcaaggacgacatggatctg
tgtttgaagatcctgcgtgacgtactgggcgaatacaaccccgaactgctctccacgttc
gacaccgtgcgtaattactcggtggaagccagcgctgaacacttcgccgagttggaggat
ccgaaccccgcacaggatggcctgaaagaggccgtgaacgtcatcgacaacatgacgcta
cacgatgcccagctgctggcccgcgcattcgccacgtacttccatctggcaaacctgtcc
gaggagaactaccgcgtttccgtgctccatgagcgcgagaacaacgtatccggcgagcag
gcggtcgatccgatcaacgagctcaccgtcgcctaccaccagctcatcaacgagatgggc
ccggccaaggccaaggagctgctcgaccagcttgagttccaccccgtcttcaccgcgcac
cccactgaagcacgccgcaaggcagtggaaggcaagatccgccgcatctccgaattgctc
ggggaatacaagattctcggcggctcggacaagaaggaatgcctgcgccgtctctacaac
gagatcgacgccctgttccgcacctctccaatcgcgctgaagaagccgaccccggttgag
gaagcggacacgattctcgacatcttcgacaacacgctgttccacaccatccccaaggtc
taccgtcgcttcgacgactggattctgggcgaccaggccgggctcgtcgaacctgtctgc
cccgcgttcttccacccgggcagctggattggctccgaccgtgacggtaacccgaacgtc
accgccaaggtgagccgcgctgtggcccgcaagttctccgatcacgtgatcgccgctctc
gaggaagccacccgtacagtgggccgcaacctcacgatggaggccgagaccacgccgccg
agcgccgagctcaagaacctgtggagccaccagaaggaaatgagcgaacgcctgaccgac
aaggccgccctgatctccaccaaggagatgcaccgcgcggtcatgctggtgatggccgat
cgtctgcattacaccatcgagcgcgatgccgacctcatgtaccactcctgcaacgacttc
ctcaacgatctcaaggtggtgcagcgttcgctggccgaggccggcgccaagcgctccgct
tacggcccgctgcaggatctgatttggcagaccgagaccttcggcttccacatggtggag
atggagttccgtcagcactccgtggtgcacgcccgcgcccttgcggatatccgcgagcat
ggtctgcacggcgagcgcggcgaactgcagccgatgacgcacgaggtgctcgacaccttc
cgcgcgctcggtgccatccagaagcgcaacggcctcaaggccgcccgccgctacatcatc
tccttcaccaagagcgcccagaacatcaaggatgtctacgagctcaaccgcttggcattc
tcccacccggaggatgtgcccaccatcgacgtgatcccgctgttcgagcagcttgaggat
ttgcagaactcggtggatgtgctcgaagaaatgattaagatccccgaggttcaggctcgc
ctcaaggccaccggcaacaagctcgaggtcatgctcggctactccgattcctcgaaggac
gccggaccgacctccgccacgctggcgctgcactccgcccaggaacgcatcgccaagtgg
gccgaatcgcacgacatcgacctgacgctgttccatggccgcggcggcgccgtcggtcgc
ggcggcggcccggccaaccgtgcggtgctcgcccagccggtcggttccgtcaagtgccgc
ttcaagctcaccgaacagggcgaggtcatcttcgcccgctacggcaacccggtgctggcc
atccgccacgtcgagtccgtggctgcggcaaccctgctgcagtccgcgccgagcgtggag
aagcgcaacaccgacatgaccaagaagtacgccgacatggctgctcagctcgacgaggcc
gcgcacaaccgcttcctcgacctgctgaacactgatggcttcgccccgtggttctcgatc
gtcacgccgctgaccgaaatcggtctgctgccgattggctcccgcccggccaagcgcggc
cttggcgccaagtccctagacgatttgcgtacgattccgtggatcttctcctgggctcag
gcacgcatcaacctggccgcttggtacggcctcggtaccgcatgcgagaagttcggcgac
ctggagaccatgcgtcaggcctacgaggaatggccgctgttctccacgttcatcgacaac
atcgagatgtccatcgccaagacggacgagcgcatcgccaagatgtacctcgccctcggc
gaccgcgaggacctcaacaagaaggtgctcgaggagatggagctcacccgcaagtgggtt
ctggacatcgtgggtgacaagtggccgctgcagcaccgccacgtgctcggccaggccatc
cgcattcgttcgccgtatgtggacgcgctgtccgtcacccaggtgctggcgctcaagtcg
ctgcgcaagaaggtggacaaggaagagctctcgcaaagccagcaggcaggattcatctat
ctgatcctctgcaccgtttcaggtgttgctgccggcctgcagaacacgggctga

DBGET integrated database retrieval system