KEGG   Bifidobacterium breve JCM 7017: B7017_0140Help
Entry
B7017_0140        CDS       T03120                                 

Definition
Amylopullulanase
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
bbrj  Bifidobacterium breve JCM 7017
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bbrj00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    B7017_0140
Enzymes [BR:bbrj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     B7017_0140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
189059..190852
Genome map
AA seq 597 aa AA seqDB search
MAVRRFGSLAKRLAVTGIAVAMSATTLVALPASADETEANAQARTSVGAPGDVIVIAFQA
NWNSVAKECTEAYGPEGVGYVQVSPPMESIQGTEWWTSYQPVSYKLDSKLGTEAEFKTMI
ATCNAAGVNIIADAVINHTTGVDQGSGTGTAGSKYDSAGNFPAAGHTKANFHTCVKNITD
YSDADEVQNCRLTGLQNLDTGQDSVQDTIASYLAKLLDMGVYGFRVDAVKHIAAQDVAAI
KARLAEKTGRDVEDIFFEQEVIGNGSEAALIQPVNYLGAGKVSEFTYNERLNAVFGGSIT
VQAGGLDAIGGSGWVISDKAAVWVTNWDTERNGSALTTRNGAKYLLANAFMLAYDYGQPH
IYSGCYYNDSDDGAPGVTDTALPDMACPTDGAEKPGTWQCAQRWTAIRGMIGFHDAVAGQ
PVSDWKKYETNVLSFERGSAGCYLAMNNSEADSTQTFAASLPACTYCNVYATGDCSDTVK
VATDGTFTATVAKGSAIAIYAGAMPDTWTGTQKYDPSNPDWFTGKASGGSDVRAGAQAES
DAFGKAQGGSDLAEELEKVEEISEETEAAAGVTICAAALVVLLCTAVGALRQRRSKT
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
gtggccgtacgacgattcggctcgctcgccaaacgccttgccgtaaccggcatagcggtg
gcaatgtctgccacaacgctggtagcattgccggcttctgcggacgagaccgaggccaat
gcacaggcgcgcacatctgttggcgcgccgggcgatgtaatcgtcatcgcattccaagcc
aactggaattcggtggccaaggagtgtaccgaggcttacggccccgaaggtgtgggctac
gtacaggtctccccgccgatggagtccatccagggcactgaatggtggacctcctaccag
ccggtcagctacaagctcgactccaagctcggtacggaagccgagttcaagaccatgatc
gccacgtgcaacgccgccggcgtcaatatcatcgccgacgcggtcatcaaccacaccacc
ggcgtggatcaaggctcaggcaccgggactgccggcagcaagtacgattccgccggcaac
ttccccgcggccggccacaccaaggcgaacttccacacctgcgtcaagaacatcactgat
tattccgatgccgacgaagtgcagaactgccgactgactgggctgcagaatctcgacacc
ggccaggattccgtgcaagacaccatcgccagttatctcgccaaactgttggatatgggc
gtctatggcttccgcgtggatgcggtcaagcatattgcggcccaggatgtggcggcgatc
aaggccaggctcgccgagaaaaccggccgtgacgtcgaagatatcttcttcgagcaggaa
gtcatcggcaatggcagcgaggcggccttgattcagccggtcaattatctgggcgccggc
aaagtctccgaatttacctataacgagcgcttgaacgcggtgttcggcggcagcatcacc
gtccaggcgggcgggctggatgccatcggcggctcgggctgggtgatctccgacaaggcc
gccgtgtgggtgaccaactgggacaccgagcgcaacggttcagcgctcaccacccgcaac
ggcgcaaaatacctgctcgccaacgccttcatgctggcgtacgactatggtcagccgcac
atctattccggctgctactacaacgattccgacgatggggcacccggtgttaccgacacc
gccttgccggacatggcctgcccgaccgatggcgccgaaaagcccggcacctggcaatgc
gctcaacgctggaccgccatccgcggcatgatcggcttccacgacgccgtggccggccag
ccggtttccgattggaagaaatacgagaccaatgtgcttagtttcgagcgcggttcggcc
ggctgctatctggcgatgaacaacagcgaagccgattccacgcagaccttcgccgcctcg
ttgccggcctgcacgtattgcaacgtttacgccaccggcgattgctcggacaccgtcaaa
gtcgcaacggacggcaccttcaccgccactgtggccaaaggctccgccatcgccatctat
gccggagcgatgcccgatacctggaccggaacccagaaatatgacccgtccaatccggac
tggttcaccggcaaggcatccggtgggtcggatgtcagggcgggcgcacaagccgagtcc
gatgcgttcggcaaggctcagggcggttctgatctcgccgaggaacttgaaaaggtcgaa
gagattagcgaggagaccgaagctgccgccggtgtcaccatatgcgcagccgcgctcgtt
gtactgctctgcaccgcggtcggtgcgctgcggcagcgccggtcaaaaacttga

DBGET integrated database retrieval system