KEGG   Bifidobacterium breve NCFB 2258: B2258_0104Help
Entry
B2258_0104        CDS       T03122                                 

Definition
Alpha-glucosidase
Orthology
K05343  
maltose alpha-D-glucosyltransferase/ alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
bbrn  Bifidobacterium breve NCFB 2258
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bbrn00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    B2258_0104
Enzymes [BR:bbrn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     B2258_0104
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     B2258_0104
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
complement(143547..145433)
Genome map
AA seq 628 aa AA seqDB search
MSGRVRHAEASPRPSWLSSARFYEVYPQSFADSNGDGIGDLRGLTERLGYIHDLGCNALW
INPCFDSPFKDAGYDVRDYTKVAPRYGTNDDLTALFEHAHTLGMHVLLDLVPGHTSEEHP
WFQASSRPDPTERVTPVDADRTIPVESVTPVGQTTPRIASLFDPRRRGSDCETIRRVVQE
SDTQESVSDRYIWTDSWISRGDNLPFIGGETERDGTYIINFFKCQPALNYGFAHPKHPWQ
KPALGPEALATCEAMLDVMRFWFSRGADGFRVDMADSLVKHDDDGKPFTIRTWQYIFSRI
RPEFPEAAFVAEWGRPYESMQAGFDMDFYLDWRWDGRPNGYNMLLRNTDTPLDHESDASY
FNADSGTSIAPFLEQYLPQLHDCERASGTFNLITCNHDTLRVAQRLTERELKVAYGMLLT
MPGCPFLYYGDEIGMRYRPLPTKEGGYVRTGSRTPMQWDADKPNLGFSCAPSESLYLPVD
SAADAPTVASEAAREDSLFNWVREVLALRTEQPALASDARFDVVAAPVDGRAFAYIRTPA
DGHASTHPRTTADSSSAPAPAATRDDVSDRNGATARPLLIAMNPGRGIETVELPSELRPD
ASMLLALGSPTVSGRTLTLPAQSFAILG
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggccgcgtacgacacgccgaagcatccccccgtccatcctggctgagttccgcc
cgtttttacgaggtttacccccaaagcttcgccgactcgaacggcgacggcatcggtgat
cttcgcggactgaccgaacgacttggctatatccatgacctgggctgcaacgcactatgg
atcaatccctgcttcgattcaccgttcaaagatgccggatatgatgtgcgcgactacacg
aaggtcgcaccgcgctacggcaccaacgatgacctgaccgccctgttcgagcacgcccac
acgctcggcatgcacgtgctgctcgacttggtccccggccacaccagcgaggagcaccct
tggttccaggccagctcacgtcctgaccctactgagcgcgttacccccgttgatgccgat
cgaactatccccgtcgagagtgttacccccgtcggacaaaccaccccccgaatcgcttcg
ctcttcgacccccgccggcgggggtcggattgtgaaacaatccggagggtggtccaggaa
tccgacacccaagaatccgtctccgaccgctacatctggaccgactcgtggatctcccgc
ggcgacaacctgcccttcattggcggcgaaaccgagcgcgacggcacctacatcatcaac
ttcttcaaatgccagcccgccctcaactacggcttcgcccaccccaaacacccatggcag
aagcccgcactcggccccgaagcactggccacctgcgaggcgatgctcgacgtcatgcgc
ttctggttctcccgcggggcagacggcttccgcgtggacatggccgacagcctcgtcaaa
cacgacgacgacggcaagcctttcaccatccgcacctggcaatacatcttctcgagaatc
cgccccgaattccccgaggcagcgttcgttgccgaatgggggcggccctacgagtcgatg
caggccggcttcgacatggacttctacctcgactggcgctgggacggccgtccgaacggc
tacaacatgctgctgcgcaatacggatacgccgctggaccacgagagtgacgccagttac
ttcaacgccgattccggcacttctatcgcaccgttcctcgaacaatatctgccgcagctg
cacgactgcgaacgagccagcggcaccttcaacctcatcacgtgcaatcacgacacattg
cgcgtggcacagaggcttaccgagcgcgagctcaaggtggcgtacggcatgctgctgacc
atgcccggctgcccgttcctttactacggcgacgaaatcggcatgcgataccggccgctg
cccaccaaggagggcggctatgtgcgcaccggcagtcgcacgccgatgcagtgggatgcc
gataagccgaatcttggcttctcctgcgcaccatccgagtcgttatatctgccggtcgat
tcggccgccgatgcgccgactgttgccagcgaagccgcacgcgaggattcactgttcaac
tgggttcgcgaggtgctggcattgcgcaccgagcagcccgcattggcttccgatgcccga
ttcgacgtggtggcagcgccagtggatggccgcgcgtttgcctacatacgcactcctgcg
gatggtcacgcgtccacccacccacgcacgaccgcggattccagctcggcccctgccccc
gccgccactcgcgatgatgtctcagaccgaaatggcgctacggcccggccgttgctcata
gccatgaaccccggtcgagggattgaaaccgtggaactgccgagcgaactccgtcccgat
gcatcaatgctgctagccctcggctcccccaccgtatccggtcgcaccttgacactcccc
gcccagtcattcgccatcctcggctag

DBGET integrated database retrieval system