KEGG   Bordetella bronchialis: BAU06_04175Help
Entry
BAU06_04175       CDS       T04591                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bbro  Bordetella bronchialis
Pathway
bbro00071  Fatty acid degradation
bbro00072  Synthesis and degradation of ketone bodies
bbro00280  Valine, leucine and isoleucine degradation
bbro00310  Lysine degradation
bbro00362  Benzoate degradation
bbro00380  Tryptophan metabolism
bbro00620  Pyruvate metabolism
bbro00630  Glyoxylate and dicarboxylate metabolism
bbro00640  Propanoate metabolism
bbro00650  Butanoate metabolism
bbro00900  Terpenoid backbone biosynthesis
bbro01100  Metabolic pathways
bbro01110  Biosynthesis of secondary metabolites
bbro01120  Microbial metabolism in diverse environments
bbro01130  Biosynthesis of antibiotics
bbro01200  Carbon metabolism
bbro01212  Fatty acid metabolism
bbro02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bbro00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BAU06_04175
   00630 Glyoxylate and dicarboxylate metabolism
    BAU06_04175
   00640 Propanoate metabolism
    BAU06_04175
   00650 Butanoate metabolism
    BAU06_04175
  Lipid metabolism
   00071 Fatty acid degradation
    BAU06_04175
   00072 Synthesis and degradation of ketone bodies
    BAU06_04175
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BAU06_04175
   00310 Lysine degradation
    BAU06_04175
   00380 Tryptophan metabolism
    BAU06_04175
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BAU06_04175
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BAU06_04175
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BAU06_04175
Enzymes [BR:bbro01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BAU06_04175
Exosome [BR:bbro04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BAU06_04175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ANN65599
UniProt: A0A193FTW5
Position
complement(949297..950481)
Genome map
AA seq 394 aa AA seqDB search
MQKDVYVVSAVRTAIGGFGGTLKNTPPAELATTVVREAVSRAGVAPEIVGHVSMGTVITT
EPRDIYLSRIAALDAGLPRAVSAYNINRLCGSGLQAIVSSAQAIAAGDCEVAVGAGAECM
SRAGYLSPSNRWGARMGDTVMLDMMLNALHDPFHGIHMGMTAENVAERFGITRRMMDELA
VASHQRAAAAIREGRFKEQIVPVKISSRRGDTWFDTDEHVKPDTTLEVLSGMKPAFKRDG
GTVTAGNSSGINDGAAALVLASADAVKAQKLTPIGRLAGYAYAGVEPALMGTGPIPATRA
VLARTGLKVADMDVIESNEAFAAQACAVMRELDFDPEKVNPNGSGISLGHPIGATGAIIA
TKALYELQRIGGRYALVTMCIGGGQGIAAIFERA
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgcagaaagacgtctatgtcgtttccgccgtccgcacggccatcggcggcttcggcggc
acgctgaagaacacgccgcccgccgaactcgccaccaccgtggtgcgcgaggcggtaagc
cgcgccggcgtcgcgccggaaatcgtcgggcatgtctccatgggaacggtcatcaccacc
gagccgcgcgacatctacctgagccgcatcgccgcgctggacgcgggcctgccgcgggcc
gtgtccgcctacaacatcaaccgcctgtgcggatccggcctgcaggccatcgtatcgtcg
gcgcaggccatcgcggccggcgactgcgaggtcgcggtcggcgcgggcgccgaatgcatg
tcgcgcgccggctacctgtcgccgtccaaccgctggggcgcgcgcatgggcgataccgtc
atgctggacatgatgctgaacgcgctgcacgaccccttccatggcatccacatggggatg
acggcggagaacgtggccgagcgcttcggcattacgcgccgcatgatggacgagctggcc
gtggccagccaccagcgcgcggcggcggcgatacgcgaaggccgcttcaaggaacagatc
gttccggtgaagatttcctcgcgccgcggcgacacctggttcgatacggacgaacacgtc
aagccggacaccacgctggaagtgctttccgggatgaagccggcattcaagcgcgatggc
ggcacggtcacggcgggtaattcctccggtatcaacgacggcgcggcggccctggtgctg
gccagcgccgatgccgtcaaggcgcagaagctgacgcctatcggccggctggccggctac
gcctatgcgggcgtcgaaccggcgctcatgggcacggggcccatccccgccacgcgcgcg
gtgctggcccgcaccgggctgaaggtcgccgatatggatgtcatcgaatcgaacgaagct
ttcgccgcgcaggcctgcgcggtcatgcgcgagctggatttcgatccggagaaagtcaac
cccaacggttcgggcatctcattgggccacccgatcggcgccaccggcgccatcatcgcc
accaaggcgctttacgaactccagcgcatcggcggccgctatgcgctggtcaccatgtgc
atcggcggcgggcaaggcatcgcggcgatcttcgagcgtgcctga

DBGET integrated database retrieval system