KEGG   Bifidobacterium breve UCC2003: Bbr_0100Help
Entry
Bbr_0100          CDS       T02534                                 

Gene name
scrP
Definition
Sucrose phosphorylase (EC:2.4.1.7)
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
bbru  Bifidobacterium breve UCC2003
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:bbru00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Bbr_0100 (scrP)
Enzymes [BR:bbru01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     Bbr_0100 (scrP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
144521..146047
Genome map
AA seq 508 aa AA seqDB search
MKNKVQLIAYADRLGDGTLSSMTDILRTRFDGVYDGVHVLPFFTPFDGADAGFDPIDHTK
VDPRLGSWDDVAELSKTHDIMVDAIVNHMSWESAQFQDVLKNGEHSEYYPMFLTMSSVFP
NGATEEDLAGIYRPRPGLPFTHYKFAGKTRLVWVSFTPQQVDIDTDSAKGWEYLMSIFDQ
MAASHVRYIRLDAVGYGAKEAGTSCFMTPKTFKLISRLREEGVKRGLEILIEVHSYYKKQ
VEIASKVDRVYDFALPPLLLHSLFTGHVEPVVHWTEIRPNNAVTVLDTHDGIGVIDIGSD
QLDRSLKGLVPDEDVDNLVNTIHANTHGESQAATGAAASNLDLYQVNSTYYSALGCNDQH
YLAARAVQFFLPGVPQVYYVGALAGRNDMELLRKTNNGRDINRHYYSTAEIDENLERPVV
KALNALAKFRNELPAFNGEFSYEADGDTSITFRWIAADGKTKAALIFEPGRGLGTDNTTP
VASLAWTDAAGDHETDDLLSNPPIADID
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacaaagtgcagctcatcgcttacgccgatcgtctcggcgatggtactcttagc
tcgatgaccgacatcctgcgcacccgcttcgacggcgtgtatgacggcgtccatgtcctg
ccgttcttcactccgttcgatggtgcggacgctggcttcgacccgatcgaccacaccaag
gtcgacccgcgcctcggatcgtgggacgacgtcgccgagctctccaaaacccacgacatc
atggtcgatgccatcgtcaaccacatgagttgggaatccgcccaattccaagacgtgctg
aagaacggcgagcactccgagtattacccgatgttcctgaccatgagttccgttttcccg
aacggcgccaccgaagaggatctcgccggcatctaccgcccgcgcccgggcctgccgttc
acccactacaagttcgccggcaagacccgtctggtatgggtcagcttcaccccacagcag
gtggacatcgacactgactccgccaagggctgggagtacctgatgtccatctttgatcag
atggcagccagccatgtgcgctacatccgtctcgacgccgtgggctacggcgccaaggag
gccggcaccagctgcttcatgacccccaagacctttaagctcatctcacgcctacgcgag
gaaggcgtcaagcgaggcctcgaaattctcattgaggtgcatagctactacaagaagcag
gttgaaatcgcctccaaggtggaccgcgtctacgacttcgccctgcctccgctgctcctg
cactcgctgttcaccggtcacgtggaacccgtggtccactggaccgaaatccgcccgaac
aacgccgtcaccgtgctcgatacgcacgacggcatcggcgtgatcgacatcggctccgat
cagctcgaccgcagcctcaagggcctcgtgcccgacgaggacgtcgataatctggtcaac
accatccacgccaacacccacggcgaatcccaggccgccaccggtgccgccgccagcaac
ctcgacctctatcaggtcaacagcacgtactactccgcgctcggctgcaacgaccagcac
tatctggccgcccgcgcggtccagttcttcctgcccggagtgccgcaggtctactacgtg
ggcgcgctcgccggtcgcaacgacatggaactgctgcgcaagaccaacaacggccgtgac
atcaatcgccattactactccaccgccgaaatcgacgaaaacctcgagcgcccggtggtg
aaggccctgaacgccctggccaagttccgcaacgaactgcctgcattcaatggcgagttc
agctacgaagccgacggcgacacatccatcaccttccgctggatcgctgccgacggcaag
accaaggccgccctcatcttcgagcccggccgcggactcggcacggataacaccactccg
gtcgccagcctcgcctggaccgatgccgccggtgaccacgagactgatgatctgctgagc
aacccgccgattgccgatatcgactaa

DBGET integrated database retrieval system