KEGG   Bifidobacterium breve UCC2003: Bbr_0116Help
Entry
Bbr_0116          CDS       T02534                                 

Gene name
malQ1
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
bbru  Bifidobacterium breve UCC2003
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:bbru00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(172642..174846)
Genome map
AA seq 734 aa AA seqDB search
MTEARSNEAATNAPDTTQRTESAERLARPLIKLAKASGLATSFIDQLGTYTEISDDALVA
VLKALDVDASSDEAIKRSMTELEAENSKRLLPPTIVATTGKPTSLTLNCPSDAEITVAIT
LEDGTAFDRFSLLPNLNSGQPDLAIAPDLPMGYHTLTVTVDGREGKATIIAAPARIAVPK
AVEEHQRWGWMTQMYSVRSHDSWGIGDYGDLKRLLADATEKSKADFMLINPIHAGAPIPP
LEPSPYLPESRRFLNVTYIRPQDIPEYATLPDDVRAQVDALHASVAARNDESTPMDINAA
WEAKRPALRLIFDAGRNNKRELEFEYFKATAGPDLNSFATWCLCFEVWGAPWGENRWFFE
KTIDDPTVQTLVKDHHDLFEFNRWLQWIAAEQVNDAQHTALDHGMTLGLMQDMAVGVHGL
GADAWANPERFASGGVTVGCPPDFYNQQGQDWGQPPFNPRYLEATGYQVYREMVHSMYEH
AGAVRIDHVLGLFRLWWIPQGLGARNGAYVMYNHEAMLGVLAIEATRAGGMVIGEDLGTV
PDYVRRILADHGVLGTDVEWFNRVDDSPNAGDPYRAPQEYRKQALASVTTHDLPPTAGYL
NFEHVKLREELHLLSEPVEVFAASAMAERTAMMNRLVEGGYITQAVADDVEGHVQEIVEA
MHAMLTDTPSLLLQAALVDGVGECRSQNQPGTSSEYSNWRVPLADDEGHVVHTDEVFDLP
RVQSLSAVMRREKR
NT seq 2205 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaggcgcgcagcaatgaagcggcaaccaatgcaccggacaccacacagcgaacg
gaaagcgccgaacgccttgctcgaccgctgatcaaattggccaaagcatccgggcttgcg
acctcgttcatcgaccagctcggcacctacaccgaaatcagcgatgacgcattggtcgcc
gtgctcaaggccctcgatgtggatgcctccagcgacgaggccataaaacgttccatgacc
gaacttgaggccgaaaacagcaaacgtttgctaccgcccaccatcgtggccaccaccggc
aagccgacaagcctgaccctgaattgcccgtcggacgcggaaatcaccgtcgccatcacg
ctggaagacggcaccgcattcgaccgcttctccctactgccgaatctcaactccggccag
ccggatctcgccatcgcccccgacctgccgatgggttaccacacgctgaccgtcacggtt
gacgggcgcgaaggcaaggcgaccatcatcgccgcccccgcacgcatcgccgtgccgaag
gcggtcgaggagcatcagcgctggggctggatgacgcaaatgtattcggtacgctcccac
gattcctggggcatcggcgactacggcgatctgaagcgtcttttggcggatgccaccgag
aagtccaaggccgacttcatgctcatcaatccgattcacgccggtgcgccgattccgccg
ctcgagccttcgccgtatctgccggaatcgcgccggttcctcaacgtgacgtacattcgc
ccgcaagacattcccgaatacgccaccctgccggatgacgtgcgcgcccaggtggatgca
ctgcatgcctcggtggccgcacgcaatgatgaatccacgccgatggatatcaacgcggcg
tgggaggccaagcgcccggccctgcgcctgatcttcgatgcgggccgcaacaacaagcgc
gagctggagttcgagtatttcaaggccacggccggcccggacctcaattccttcgccacc
tggtgcctgtgcttcgaggtgtggggcgcaccttggggcgagaaccgctggttcttcgag
aagaccatcgacgacccgaccgtgcagacgctggtcaaggaccatcatgatctgttcgag
ttcaaccgctggctgcagtggatcgccgccgagcaggtgaacgacgctcagcacacggcc
ttggatcatggcatgacacttggccttatgcaggatatggccgttggcgtgcacgggctc
ggcgctgacgcgtgggccaacccggagcgtttcgcctccggtggcgtcacggtcggctgc
ccgccggacttctacaaccagcagggccaggattggggccagccaccgttcaacccgcgt
tatctggaagccaccggctaccaggtgtaccgcgaaatggtgcattccatgtatgagcat
gcgggcgcggtgcgtatcgatcacgtgctgggactgttccgcctgtggtggattccgcag
ggacttggcgcccgcaatggcgcctacgtgatgtacaaccacgaggcgatgctcggcgta
ctggccatcgaggccacgcgcgccggcggcatggtgatcggcgaggatttgggcaccgtg
ccggattatgtgcgccgcattctggccgatcatggcgtgcttggcaccgatgtggagtgg
ttcaaccgtgtggacgattcgccgaacgccggcgatccctaccgcgcgccgcaggagtac
cgcaagcaggcactggcatcggtcaccacacacgatctgccgccaaccgccggctatctg
aacttcgagcatgtgaaactgcgcgaggagctgcatttgctcagcgagccggtggaggtg
tttgccgcttcggccatggccgagcgcaccgcgatgatgaaccgactggtggagggcggt
tatatcacgcaggctgtggccgatgacgtggaaggtcatgtgcaggagatcgttgaagcc
atgcacgccatgctcactgatacgccgtcgctgttgttgcaggctgcgctggtggacggc
gtgggcgaatgtcgctcgcagaatcagccgggcacgtccagcgagtattccaactggcga
gtgccgctggcagatgacgaagggcacgtagtacacaccgacgaggtcttcgacctgccg
cgcgtgcagtccctgtccgccgtaatgcgccgcgagaagcgctga

DBGET integrated database retrieval system