KEGG   Bifidobacterium breve UCC2003: Bbr_0306Help
Entry
Bbr_0306          CDS       T02534                                 

Definition
O-Glycosyl hydrolases family 30, Glucosylceramidase (EC:3.2.1.45)
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
bbru  Bifidobacterium breve UCC2003
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bbru00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Bbr_0306
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Bbr_0306
Enzymes [BR:bbru01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     Bbr_0306
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
423197..424528
Genome map
AA seq 443 aa AA seqDB search
MGAKIFRTISQRHLMEPIEQASHEGTFDVEIMMKPGETMQRVVGFGASLTDSSAYLLNET
LDDESRKQAMTDLFDPDQGIGLSMLRNPMGASDYARDVYSYDDMPDGKRDDSMEHFSIAR
DERNVIPLIHEAKRLNPDLKVVMSPWSAPAWMKTNGSMKAGSLREDCRETYARYFVQCLR
AYRSHGIEVHAVTPQNEPLYEPTHYPSMAMSAQEETVFVRDHLRTAMREAGFKTLILGYD
HNWDRCDYPLALLDGAAESFDGIAWHWYAGDPQSQSVVSERHPGKLSYVTEASGGEWIPG
FEPAFSHLVGMIIQALNHGANAFVLWNIALDEHRGPTVPGFGESTCGGLLRVDSERRKAS
KEIDYYGLAHFSRHIRPGAHVVPTIATGNTDGARCVAALNEDGSRAMVLLNDGESPITVR
AGWEDNAANVTLTPKAVATIVWR
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgggagcgaagatcttccgcaccatttcccaaaggcatctcatggaacccatcgaacaa
gcctcgcacgaggggacgttcgacgtggagatcatgatgaaacccggggaaacgatgcag
cgcgtcgtcggcttcggcgcgtccctcacggactcctccgcgtatctgctcaacgagacg
ctggacgatgagagcagaaaacaagccatgacggacctcttcgacccggaccagggcatc
ggcctgtcgatgctccgcaatccgatgggcgcaagcgattacgccagggatgtctacagc
tacgacgacatgccggatgggaaacgggacgactcgatggagcatttctccatcgcgcga
gacgaacgcaacgtgatacccctgatccacgaggccaagcggctgaaccccgacctgaag
gtcgtgatgagcccatggagcgcccccgcatggatgaagaccaacggaagcatgaaggcg
ggaagcctcagggaagactgccgggaaacctacgccaggtatttcgtccagtgcttgcgc
gcctacaggtcccacggcatcgaagtacatgccgtcacgccccagaacgagcccctgtac
gagcccacccattaccccagcatggcgatgagcgcacaggaggagaccgtcttcgtcagg
gaccatctcaggacggccatgcgcgaagcgggattcaagacgctgatactcggatacgac
cacaattgggacagatgcgactatccgctggcgttgcttgacggcgcggccgaatcgttc
gatggaatcgcatggcattggtacgcgggcgacccccaatcgcagagcgtcgtgtccgaa
cgccaccccgggaaactctcctatgtgaccgaagcgtcgggcggagaatggatccccggg
ttcgaaccggcgtttagccacctggttggcatgatcatccaggcactgaaccatggggcg
aatgcgttcgtcctatggaacatcgctttggacgagcatcgcggaccgacggtgcctgga
ttcggggaatccacatgcggggggctgctgcgcgtcgactccgaacgtcgcaaggcgagc
aaggagatcgactactacgggctggcgcatttcagccgtcacattcgtccgggggcccat
gtcgtccccaccatcgcaacgggaaacacggacggcgcgcgatgcgtggcggcgctcaac
gaagatggaagccgcgccatggttcttctgaacgatggggaatctccgataaccgtcagg
gcggggtgggaggataacgcggccaacgttacgctgacgcctaaagccgtcgctacgatc
gtatggaggtga

DBGET integrated database retrieval system