KEGG   Bifidobacterium breve UCC2003: Bbr_0999Help
Entry
Bbr_0999          CDS       T02534                                 

Definition
Aminotransferase (EC:2.6.1.-)
Orthology
K14260  
alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
bbru  Bifidobacterium breve UCC2003
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; 2-Oxocarboxylic acid metabolism [PATH:bbru01210]
Metabolism; Overview; Biosynthesis of amino acids [PATH:bbru01230]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:bbru00250]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine biosynthesis [PATH:bbru00290]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1263862..1265397
Genome map
AA seq 511 aa AA seqDB search
MSVSAFAERLRNAMNSRELKQVDLVHAAERRGVKMGKSHISQYVAGKTMPREDVLLFLAD
ELDVDANWLRGRSSETKLNSDAQPASHIDTPSGAPTSAETEIPAARRRTFGKSHKLDDVL
YDVRGPVVDEAARMEQAGTHVLKLNIGNPAPFGFRTPDEVVYDMAQQLPETEGYSASKGL
FSARKAIMQYAQLKNIPNVTIEDIYTGNGVSELINLSMSALLDSGDEVLVPSPDYPLWTA
CVNLAGGTAVHYLCDEKSDWYPDIDDMRKKITDRTVAIVLINPNNPTGALYPKEVLQQIV
DLAREHQLMIFSDEIYDRLVMDGLEHISIASMAPDLFCVTFSGLSKSHMIAGYRVGWMIL
SGNKAIAKDYIEGINMLTNMRICSNVPAQSIVQTALGGHQSVHDYIVPGGRIHDQRDYIY
DALNSIPGITAVKPKAAFYIFPKIDIKKFNVHDDEQFALDLLHDKRILITRGGGFNWHEP
DHFRIVYLPRIEVLKDATNKLSDFLSYYWQS
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtatcggcgtttgcggaacgactgcgcaatgcgatgaacagtagggaattgaag
caggtagatctggtgcacgccgccgaacgccgcggtgtcaagatgggcaaaagccatatc
agccaatatgttgcgggcaagaccatgccgcgagaggatgtgctgctgtttctggctgac
gaacttgatgtcgatgcgaactggcttcgtggccgatcctcggaaacaaaattgaactcc
gacgcacaacccgcttcccatattgacacaccgagcggagctcccacgtcggcggaaacg
gaaattcctgctgctcgccgccgtacctttggcaaatcacacaagcttgatgacgtactc
tacgatgttcgcggcccagtggttgatgaggcggcccgcatggaacaggccggcacccac
gtactgaagctcaacattggcaaccctgcaccgttcggcttccgtacgccggacgaggtc
gtctacgacatggcgcaacaattgcctgaaaccgaaggctattcggcttccaagggcctg
ttctccgcgcgtaaggccatcatgcagtatgcacagctcaagaacattccgaacgtcacc
atcgaagacatctacaccggcaatggtgtcagcgagctcatcaacctgtctatgtccgcg
ctgctcgacagtggcgatgaagtgcttgtgccatctccggattacccgctgtggaccgcc
tgtgtgaatctcgccggcggcaccgccgtgcattacctgtgcgacgagaagtccgactgg
tacccggatatcgacgatatgcgtaagaagatcaccgatcgtaccgtggccatcgtgctc
atcaatccgaacaatccgaccggtgcgctgtatccaaaggaagtgctgcagcagattgtc
gacttggcgcgtgagcaccagctcatgattttctccgacgaaatctacgatcgtctggtt
atggacgggctcgagcatatctccatcgcttccatggctccggatctgttctgcgtgacc
ttctccggcctgtccaagtcgcatatgatcgccggctaccgcgtgggctggatgattttg
tcgggcaacaaggccatcgccaaggattacatcgagggcatcaatatgctcaccaacatg
cgcatctgttcgaacgtgcccgcgcagtccattgtgcagaccgcgctgggcggccatcag
agcgtgcacgactatatcgtgcccggtggccgtatccatgaccaacgtgattacatctat
gacgcgttgaactccattccgggcatcaccgcggtcaagccgaaggccgcgttctatatc
ttcccgaagattgatatcaagaagttcaacgtacatgacgacgagcagttcgccctcgat
ctgctgcatgacaagcgcattctcatcacgcgcggcggcggcttcaactggcacgagccg
gatcacttccgtatcgtctacctgccacgcatcgaagtgctcaaggatgccaccaacaag
ctctccgacttcctcagctactactggcagagctga

DBGET integrated database retrieval system