KEGG   Bifidobacterium breve UCC2003: Bbr_1432Help
Entry
Bbr_1432          CDS       T02534                                 

Gene name
rbsK4
Definition
Ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
bbru  Bifidobacterium breve UCC2003
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:bbru00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Bbr_1432 (rbsK4)
Enzymes [BR:bbru01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Bbr_1432 (rbsK4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1783137..1785038
Genome map
AA seq 633 aa AA seqDB search
MNIRDIARIAGVSTSTVSKIVNGKDSSISEETRKKVLTIVKEYHYKPYASAAQRTRSYTI
GVLLRSPISFDSTLDGIIQAAQNAGYATDAYNSYSDPERELKNIAAICGRNVDGVIWEPA
TPDSLAYASQFPEGTPLLTIGPNGGDQSLLLPYKEAAYKLTNELIERGHQHIACLMTRGR
RTQDFLEGFRSCLFDHQLPYSDDLVYYDLNDSLPSKIGSRDITGFVSSHYRRALEFTQMI
RPLHYRLPEDASLVSIKNDTTEALAYPGNAEISTYTIRNSDFGAYLCEKLIAQIEHDKEQ
HPSFVQDFHLDNTSTVAAPPTSAVKHVLVVGSINIDHYLSMPRLPHIGGTVSTKSAARYP
GGKGVNQAIGAAKLGHHVTLIGNVGVDNGSDYIFKAMEQHGVNTAGVRRCAGEDTGSSFI
FLDPNGESIIAILSGANASLTPDDITSNERLFDNAGYCLIQTEIPLESAKVAAITARRHH
AKTIIKPSSCDYLPDSIVANADILVPNEHELAIIETEGKTMEDKAAHLLERGAGCVIVTQ
GEHGCYLRGQNVECHYPAADFSPVDSTGAGDAFISALASYLMYGCTVRQAVEIATYAAGY
SITRKGVIPSLIDRLSLDVYVHHSERQQRGHLS
NT seq 1902 nt NT seq  +upstreamnt  +downstreamnt
atgaacatcagggacatcgcacgcatcgcgggcgtctccacctcgacggtctccaagatc
gtcaacggcaaggattccagcatcagcgaggaaacccgcaagaaggtcctgacgatcgtc
aaggaataccattacaagccatatgcctctgccgcgcagcgcacgcgcagctacaccatc
ggagtgctgctgcgctcccccatctctttcgatagcacgctggatggcatcatccaggct
gcccagaacgccggatatgcgaccgatgcctacaacagctactccgatccggaacgtgag
ctcaaaaacatcgcggcaatatgtgggcgcaacgtcgacggcgtcatctgggagccggcc
accccggacagtctcgcttatgcctcgcagttccccgaaggcaccccgttgctgaccata
ggacccaacggcggcgaccagtcactgctgctgccttataaagaggcggcctataaattg
accaacgagctcatcgaacgaggtcaccaacacatcgcctgcctaatgaccagaggccgc
cgcacacaggattttctcgaaggcttccgctcatgcctgttcgatcaccagctgccatat
agcgacgacttggtctactacgacctcaacgattcactgcccagcaaaatcggaagccgt
gacatcaccggatttgtctcctcgcattacaggcgagcactcgagttcacgcagatgatc
cgccccttgcattaccggctaccggaggacgcctcgctcgtctccatcaaaaacgacacc
accgaggcactggcttatcccggcaatgcggaaatatccacctacaccatccgcaactcc
gacttcggcgcctacctctgtgagaagctcattgcacagatagagcacgacaaagagcag
catccctcgttcgtacaggattttcatctcgacaacaccagcacggtcgccgctccgcct
acttccgccgtcaagcacgtgttggtcgtcggcagcatcaatatcgaccactatctgtcg
atgccgcggctacctcacatcggaggcacggtatccaccaaatcggcggcacgctacccc
gggggcaaaggggtcaatcaggcaatcggtgcggccaagctcggacatcacgtcaccctc
atcggcaatgtcggcgtcgacaatgggtccgattacattttcaaggcgatggagcagcat
ggggtcaatacggccggcgtgcgacgctgcgccggagaagacaccggttcgtcgttcata
ttcctcgaccccaacggcgaatcgattatcgcgattctctccggagccaacgcatcgctt
accccggatgacatcacctccaacgaacgactgttcgacaacgccggatactgcctgata
cagactgaaataccgttggaatcggccaaagtcgccgcgatcactgcccgacgacaccat
gccaaaaccattatcaagccctcgtcatgtgactatctgcccgactccatcgtcgccaac
gccgacattctcgtgccgaacgagcacgaactggcaatcatcgaaactgagggaaaaacg
atggaggataaggccgcgcatcttctcgaacgcggcgcgggctgcgtcatcgtcacccaa
ggagaacacggctgctacctgcgcggccagaatgtcgagtgtcactatccggccgctgac
ttctcccccgtagacagcaccggggccggcgacgcgttcatcagcgcgctcgcctcgtat
ctgatgtatggatgcaccgtgcggcaggcggtcgaaatcgccacctatgccgccggatac
tcgatcacccgcaaaggcgtcattccctcgcttatcgaccggctctcgctggatgtctac
gtccatcacagcgagcgacagcagcgcggtcatctgtcttaa

DBGET integrated database retrieval system