KEGG   Bifidobacterium breve UCC2003: Bbr_1495Help
Entry
Bbr_1495          CDS       T02534                                 

Gene name
folE
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
bbru  Bifidobacterium breve UCC2003
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bbru00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1863267..1863926)
Genome map
AA seq 219 aa AA seqDB search
MNEYIESCPRWRGLAAQPTGGGSGAESRQREESSYDEGGVRQAVRLFLKSIGEDPEREGL
VETPDRIARACRELFAGLQASPADVLEKHFDVDTDELVLVKDIELYSVCEHHLLPFHGVA
HVGYIPAKDGVMGLSKLARLVEVYARRPQVQERLTQQIADALVEYAGARGVIVVTECEHL
CMSMRGIKKSSARTVTSAVRGLLRNPATRAEAMSLILDK
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaatatatagaatcttgcccccgctggcgggggctggcggcgcagccgactggg
ggtggttctggggccgaaagtcgccagcgggaggaatcctcatacgacgaaggaggcgtg
cgtcaggcagtacgcctgttcctgaagtcgatcggtgaggatcccgagcgcgagggactg
gtggagacacccgaccgcatcgcccgtgcctgccgtgagctgttcgccggcctgcaggcc
tcgccggccgatgtgctggagaagcatttcgatgtggataccgacgagctggtgctggtc
aaggacatcgaactgtattcggtatgcgagcatcatctgctgccgttccacggcgtggcc
catgtgggctatattccggccaaggatggggtgatgggcttgagcaagctggcccgactg
gtcgaggtgtatgcccgccgtccacaggtgcaggagcgcttgacccagcagatcgccgat
gcactggtcgaatatgcgggcgcgcgtggcgtgattgtggtgaccgaatgcgagcacctg
tgcatgtcgatgcgtggcatcaagaagtcctccgcccgtacagtgacctccgcggtgcgt
ggcctgctgcgcaaccccgccacccgagccgaggccatgagcctgattctggataaatag

DBGET integrated database retrieval system