KEGG   Bifidobacterium breve UCC2003: Bbr_1645Help
Entry
Bbr_1645          CDS       T02534                                 

Gene name
adh2
Definition
Aldehyde-alcohol dehydrogenase 2
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
bbru  Bifidobacterium breve UCC2003
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bbru00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Bbr_1645 (adh2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bbr_1645 (adh2)
   00620 Pyruvate metabolism
    Bbr_1645 (adh2)
   00650 Butanoate metabolism
    Bbr_1645 (adh2)
  Lipid metabolism
   00071 Fatty acid degradation
    Bbr_1645 (adh2)
  Amino acid metabolism
   00350 Tyrosine metabolism
    Bbr_1645 (adh2)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Bbr_1645 (adh2)
   00626 Naphthalene degradation
    Bbr_1645 (adh2)
Enzymes [BR:bbru01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Bbr_1645 (adh2)
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Bbr_1645 (adh2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2027950..2030679)
Genome map
AA seq 909 aa AA seqDB search
MAEAKKKVEATKPTPEEKQAAAEAEVDALVTKALKALDEFEALDQKQVDRIVAKASIAAL
NKHLVLAKMAVDETGRGLVEDKATKNIFACEHVTNYLAGQKTVGVIREDDVMGIDEVAEP
VGVVAGVTPVTNPTSTAIFKSLIALKTRCPIVFGFHPGAQKCSVEAAKIVRDAAIEAGAP
ENCIQWIEHPSIQATGALMQHPGVATILATGGPGMVKAAYSSGKPALGVGAGNAPAYVDS
DVDIVRAANDLVLSKHFDYGMICATEQAIIAHKDVYAPLIKELKLRKAYFVNAEEKAKLE
KYMFGCVAGSGEKPVLNSVVPGKSPQFIAKAAGFDIPEDATILAAECKEVSDDEPLTHEK
LAPVQAVLKADNKEQAFEMCEKMLKLGAGHTAAIHTNNQELVREYGVRMHACRIIWNQPS
SLGGIGDIYNAIAPSLTLGCGSYGGNSVSGNVQAVNLVNIKRIARRNNNMQWFKIPAKTY
FEPNAIKYLRDMYGIEKAVIVCDKVMEQLGIVDKIIDQLRARSNRVTFRIIDYVEPEPSV
ETVEKGAAMMRDEFEPDTIIAVGGGSPMDASKIMWLLYEHPEIAFSDVREKFFDIRKRAF
KIPPLGKKAKLVCIPTSSGTGSEVTPFAVITDHKTGYKYPITDYALTPSVAIVDPVLART
QPRKLASDAGFDALTHSMEAYVSVYANDFTDGMALHAAKLIWDNLAESVNGEPGLAKTDA
QEKMHNAATMAGMAFGSAFLGMCHGMAHTIGALCHIAHGRTNSILLPYVIRYNGQIPEEP
TSWPKYNKYVAPERYQDIARNLGIDTGKTPAEAVENLAKAVEDYRDNKLGMNKSFQDCGV
DEDYFWSVLDQIGMRAYEDQCTPANPRIPLINDMKDIAVGAYYGVSQEEGHKLRIEREGE
AATEEASER
NT seq 2730 nt NT seq  +upstreamnt  +downstreamnt
gtggcagaagcaaagaagaaggtcgaagctaccaagccgacccctgaagagaagcaggcc
gcagccgaggccgaggttgacgcgctggtcaccaaggcgctcaaggctcttgacgaattc
gaagcccttgaccagaagcaggtcgaccgcatcgtcgccaaagcatccatcgccgctctg
aacaagcacctcgtactcgccaagatggccgtcgatgagaccggccgtggcctcgtggaa
gacaaggccaccaagaacatcttcgcctgcgagcacgtcaccaactatcttgccggccag
aagaccgtcggtgtcattcgcgaagacgacgtgatgggcatcgacgaagtcgctgagccc
gtcggcgtggtcgccggcgtcaccccggtcaccaacccgacctccaccgccatcttcaag
tccctcatcgccctgaagacccgctgcccgatcgttttcggcttccatcctggcgcacag
aagtgctccgttgaggccgccaagatcgtgcgcgacgccgccatcgaggccggtgctcct
gagaactgtatccagtggatcgagcacccgtccatccaggccaccggcgccctgatgcag
cacccgggcgtggccaccattctcgccaccggtggtccgggcatggtcaaggcagcctac
tcctccggcaagcccgccctcggtgtgggcgccggtaacgctccggcctatgtcgattct
gacgtggacatcgtgcgcgccgccaacgatctggtgctctccaagcacttcgattatggc
atgatctgtgccaccgagcaggccatcatcgcccacaaggacgtctacgccccgctcatc
aaggaactcaagctgcgcaaggcctacttcgtcaatgccgaagagaaggccaagctcgag
aagtacatgttcggctgcgtggccggttccggtgaaaagccggtgctgaactccgtcgtg
ccgggcaagtccccgcagttcatcgccaaggccgccggcttcgacattcctgaggatgcc
accatcctcgccgcggagtgcaaggaagtctctgacgatgagccgctgacccacgagaag
ctcgctccggtgcaggccgtcctcaaggccgataacaaggagcaggccttcgagatgtgc
gagaagatgctcaagctgggtgccggccacaccgccgccatccacaccaacaaccaggag
ctcgtgcgcgagtacggtgttcgtatgcacgcctgccgcatcatctggaaccagccttcc
tctctcggcggcatcggtgatatctacaacgccatcgccccgtccctgaccctcggctgc
ggctcctacggcggcaactcggtttccggcaacgtgcaggccgtgaacctcgtcaacatc
aagcgcattgctcggaggaacaacaacatgcagtggttcaagatcccggccaagacctac
ttcgagccgaacgccatcaagtacctgcgcgacatgtacggcatcgagaaggccgtcatc
gtctgcgataaggtcatggagcagctcggcatcgttgacaagatcatcgaccagctgcgt
gcccgttccaaccgcgtgaccttccgcatcatcgactacgtcgagccggagccctccgtc
gagaccgtcgaaaagggtgcggccatgatgcgcgacgagttcgagccggacacgatcatc
gcggtcggcggcggctccccgatggacgcctccaagatcatgtggctgctctacgagcac
ccggaaatcgccttctccgatgtgcgcgagaagttcttcgatatccgtaagcgcgccttc
aagattccgccgctgggcaagaaggccaagctggtgtgcatcccgacttcctccggcacc
ggttccgaagtcacgccgttcgctgtgatcaccgaccacaagaccggctacaagtacccg
atcaccgactacgccctgaccccgtccgtggccatcgtggatccggtgctggcccgcacc
cagccgcgcaagctggcctccgacgccggcttcgacgccctgacccactcgatggaagcc
tacgtgtccgtgtacgcgaacgacttcaccgacggcatggcgctgcacgctgccaagctc
atctgggacaacctggctgagtccgtcaacggcgagcccggcctggccaagaccgacgcc
caggagaagatgcacaacgccgccaccatggccggcatggcgttcggctccgcgttcctt
ggcatgtgccacggcatggcccacaccatcggtgctctgtgccacatcgcccacggccgt
accaactccatcctgctgccgtatgtgattcgttacaacggccagattcctgaggagccc
acctcttggccgaagtacaacaagtacgtcgctccggagcgctaccaggacatcgcccgc
aatctcggcatcgacaccggcaagaccccggccgaagccgtggagaacctggctaaggcc
gtcgaggattaccgcgacaacaagctcggcatgaacaagagcttccaggattgcggcgtg
gatgaggattacttctggtccgtgcttgatcagatcggcatgcgtgcctacgaggatcag
tgcaccccggctaacccgcgcatcccgctgatcaacgacatgaaggacatcgccgtcggt
gcctactacggcgtctcccaggaggaaggccacaagctgcgcatcgagcgcgaaggcgag
gccgccactgaggaagcctccgagcgctga

DBGET integrated database retrieval system