KEGG   Bifidobacterium breve UCC2003: Bbr_1650Help
Entry
Bbr_1650          CDS       T02534                                 

Gene name
malQ2
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
bbru  Bifidobacterium breve UCC2003
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bbru00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Bbr_1650 (malQ2)
Enzymes [BR:bbru01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Bbr_1650 (malQ2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2036990..2039125)
Genome map
AA seq 711 aa AA seqDB search
MARPLIRLAKLVGIGTSYVGMSHDYHEIDDDVLIEILSALGIEARNDDRQKEAIHRILKE
RHSRLVAPTVLHTVGEEDRLLVNTGIMEIPSASIILENGESYEGTIGVGPGDGSPAFDLD
GNFVSTASLIIPADVPVGYHTLHVKVGNRSQDATLISAPSQVPLIDPMKDGSLWGWMAQL
YSIRSSGSWGVGDYEDLKTILVDAKRKTGADFVLVNPLHAAEPVSPLTPSPYLPVSRRLV
NFTYIRPESVPEYATLPTDAKNEVDGLHSDVEPLNGDAQVIDRDAMWRSKMHALWIIFKA
GRTAERQAAFDQFKTDFGSDLEAYATWCLCYDKWGAPSAQGDNWEQALGRDSQQIADLKR
QFPDTLDFYRWLEWVASDQLAAAQQAAKDAGMEIGIMSDMAVGVHPLGADVWWNPERFAK
GATVGAPPDMFNQQGQNWSQPPLSPLDLEATGYQTYRNMVHGMFARAGAVRIDHILGLFR
LWWIPENHSATDGAYVHYDSNIMLGILAIEASRANGVVVGEDLGVMPDYVADSLSGHGIL
GCAVEWFEQRDGVFRTPSQWRPYALASVNTHDLPPAAGYLEYEHVKIRERLGLLTGPAEE
FQASAKAEQNAMIAMLVDQGYLDVDFAEHREEHEADIIDALYRALKGSPCKLLAASITDA
VGEKRAQNQPGTNNEYPNWRIPLADDKGNVVPLETLFDTPGAQRFAQIFNN
NT seq 2136 nt NT seq  +upstreamnt  +downstreamnt
ttggctcgtccgctgattcgattggccaaattggtgggtatcggtaccagctatgtgggc
atgagccacgattatcatgagatcgacgatgatgtgctcatcgaaatcctgtctgctcta
ggcatcgaagcccgaaacgacgatcggcaaaaggaagccattcacaggattttgaaggaa
cgccatagccgactggttgctccaacagtgttgcataccgtcggcgaggaagaccgtctg
ctcgttaacaccggcatcatggagataccttctgcaagcatcatcctggagaatggtgag
tcatacgaggggaccatcggagtcggtccgggagacggatctccggcgttcgatttggat
ggtaactttgtgtctacggcatcgctgatcattcccgccgatgtaccggtcggctatcac
accctgcatgtcaaggtcggtaaccgttcgcaggacgccaccctgattagcgcgccgagc
caggttccgttgattgacccgatgaaggacggtagcctgtggggctggatggcgcagctg
tactcgattcgttcctccggatcatggggtgtcggcgattacgaggatttgaagaccata
ttggtcgacgccaagcggaagaccggcgctgattttgtgctggtcaatccgttgcacgcc
gccgaaccggtgtctccgcttacgccgtcgccgtatcttccggtgagccgtcgtctggtc
aatttcacgtatattcgccctgagtcggtaccggaatacgccacattgccgaccgatgcc
aagaatgaagtggatggactgcactccgatgtggagccgctgaacggcgatgcccaggtc
attgaccgtgacgccatgtggcgcagcaagatgcatgctctgtggattatcttcaaggcc
ggtcgcactgccgagcgtcaggccgcattcgatcagttcaagacggatttcggttccgac
ctcgaagcctatgccacgtggtgcctgtgttatgacaagtggggtgcgccctcggcacaa
ggcgacaattgggaacaggccctcggccgggattctcagcagattgctgatttgaagcgt
caattccccgatacgctcgacttctaccgctggctcgaatgggtggcgtccgatcagctt
gccgctgcgcagcaggcggccaaggatgccggcatggaaatcggcatcatgtctgatatg
gcggtcggtgtgcatcccctcggcgcggatgtgtggtggaatcctgagcggttcgccaag
ggcgctacggttggcgctccgccggatatgttcaaccagcagggccagaattggagccaa
ccgccgctgagcccgcttgatttggaagccactggctaccagacctaccgcaacatggtg
catggtatgttcgcccgtgccggtgccgtgcgcatcgaccatatccttggtctgttccgt
ctgtggtggattcctgagaatcattcggcaacggatggtgcctatgtgcattacgattcc
aacatcatgctcggcattctggccatcgaggcgtcccgcgccaacggcgtggtggtcggt
gaggatttgggcgtgatgcccgattatgtggccgattccctgtccggccacggcattctc
ggctgtgcggtcgaatggttcgagcagagggacggggtgttccgcacaccatctcaatgg
cgtccgtatgccttggcgtccgtgaatacccatgacctgccgccggccgccggatacctg
gagtatgagcacgtcaagattcgcgaacgcttggggctgctgactggccctgctgaggag
ttccaagcttctgccaaggctgagcaaaacgccatgattgctatgctggttgatcaagga
tatctggatgtcgatttcgccgaacaccgtgaggagcacgaggcggacatcatcgatgcg
ttgtaccgtgcgctgaagggatctccgtgcaagctgcttgccgcctcgattaccgatgcg
gtgggggagaagcgtgcgcagaaccagcccggcaccaataacgagtatccgaactggcgt
atcccgctggccgacgataagggcaatgtggtgccgctcgaaaccctcttcgataccccc
ggtgcccaacgtttcgcccaaatcttcaataactga

DBGET integrated database retrieval system