KEGG   Bifidobacterium breve UCC2003: Bbr_1869Help
Entry
Bbr_1869          CDS       T02534                                 

Gene name
aga
Definition
Alpha-galactosidase (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
bbru  Bifidobacterium breve UCC2003
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:bbru00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:bbru00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:bbru00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2342034..2344349)
Genome map
AA seq 771 aa AA seqDB search
MAQNTATFTGTAADGTALTAIYLVQPDANVAIGLVAAGDDLPRIIHWGRPLSNPETLLAA
YDALKPQRVSGALDDTAWPSILPTQAESWIGEQRVVLRRDGIELFPKFTVTGMKFDGVVA
ASLDAVSGDSYTDVTGRARTTGPANVPGVAITARDEEQGVELEWHLELLPGGLARQKAIV
TNLFGAEAGAEAPLEIGKIELGFPLPESASEILTTTGHHLRERSPQRQPLTIGRFEKPQL
AGRPDFDASLLLTAGVPGFGFEHGEAYSVHVGWSGNSVLSAERLPYTQGVIGGGELLFGG
EVTLDDAAGEGQSSYETPWLFGSFGDGLNEIAARFHSYVRSLHPRLFSHGRPVILNTWEA
VYFDHNFDTLKALADKAAASGVERFVVDDGWFGSRRDDTSGLGDWQISQDVWPDGPKSLK
ALADYVHAKGMEFGLWFEPEMVNPDSDVARNHPDWILSPTAGRLPLQGRTQQVLDLTNPE
AFDYIYSCMDQLVGELGIDYIKWDHNKLVTEPGSRRSGRPAVHAQTIAVYEIFRGLKTAH
PGLEIESCSSGGGRVDLGILEYADRIWVSDCVDPVERADIQRYTSLLVPPAMMGEHVGAS
PAHSTRRETSQELRMAMAFFGHMGIEWNLLKEPDDALAKLAVWVAEFKKHRDWFAIDTCV
HADSSDPAVRLDGMVMPNRNAAIYRFAQLTTSQTYPAAPVHLPGLDPKRKYRISPLDPSL
DLEGLTNGQSTLGWWNEEGVVLTGEALQRYGIRPPSLHPQQAVLFKAVALS
NT seq 2316 nt NT seq  +upstreamnt  +downstreamnt
atggcccagaacaccgccaccttcaccggtaccgccgctgacggaaccgcgctcaccgcc
atctatcttgtacagcccgatgccaacgtggcaatcggtctggtcgctgccggcgatgac
ctgccgcgtatcattcattggggtcgcccgctgagcaatcctgagaccttgctcgctgcg
tatgatgcactcaagccgcagcgcgtttccggtgcactcgatgacaccgcctggccgtcc
atcctgccgacacaggccgaaagctggattggcgagcagcgtgtggtgctgcgccgcgac
ggcatcgaactcttccccaagttcaccgtgaccggtatgaaattcgacggcgtggtggct
gctagcctcgatgctgtgtccggcgacagctacaccgatgtgactggacgtgcccgtacc
actggcccggccaacgtgcccggcgtggcaatcactgcgcgcgacgaagagcaaggcgtg
gaactcgaatggcatctcgaacttctgcccggtggtttggcccgtcagaaggccatcgtg
accaacctgttcggagcagaagccggtgccgaggccccgctggaaatcggcaagatcgag
ctcggtttcccgctacccgaatccgcatccgaaatcctgaccaccaccggccaccatctt
cgcgaacgcagcccgcagcgtcagccgctcaccatcggacgttttgagaagccgcagctc
gcgggtcgccctgatttcgacgcctccctgctgcttaccgccggcgttcccggcttcggc
ttcgagcatggcgaagcctactcggtgcacgtgggctggagcggcaactccgtgctgtcc
gccgagcgactgccgtacacgcagggtgtgattggcggcggcgagctgctgtttggcggc
gaagtaacgcttgatgatgcagccggcgaaggccagagctcttacgaaaccccatggctg
ttcggctccttcggcgatggtctgaacgagattgccgcacgcttccactcctatgtgcgt
tctttacacccgcgcttgttctcgcacggccgtccggtaatcctcaacacctgggaagcc
gtgtacttcgaccacaacttcgatacgctcaaggcgctcgccgacaaggcagccgcttct
ggtgtggaacgattcgtggtggatgacggttggttcggttctcgccgcgacgacacctcc
ggccttggcgactggcagatttctcaggacgtatggcccgatggcccgaagtccctcaag
gcgctcgccgattatgtgcatgccaagggcatggagttcggcctgtggttcgagccggaa
atggtcaaccccgattccgacgtggcccgcaaccaccctgattggattctttcgcccact
gccggccgtctgccgctgcagggccgcactcagcaagtgctcgacctgaccaatccggaa
gctttcgattacatttacagctgcatggatcagctcgtcggcgagctcggcatcgactac
atcaaatgggatcacaacaagctggtcactgagcccggttctcgccgctccggccgtccg
gccgtgcatgcgcaaactattgccgtctatgagattttcaggggcctcaagaccgctcac
ccgggtctcgaaatcgaaagctgctcttccggtggcggccgtgtggatctcggtatcctc
gaatacgccgaccgtatctgggtgtccgattgcgtggatccggtcgaacgcgcggacatc
cagcgttacacatcactgcttgtgccgcctgccatgatgggcgagcatgtgggtgccagc
cccgcgcactccactcgtcgtgagaccagtcaggaattgcgcatggcgatggcattcttc
gggcacatgggcatcgaatggaacctgctcaaggagccggacgatgcacttgccaagctg
gcagtgtgggtggccgagttcaagaagcatcgtgattggttcgccatcgatacctgcgtg
cacgccgactccagcgatccggccgtgcgcctcgatggcatggtgatgccgaaccgcaat
gctgccatctaccgcttcgcccagctgaccacgagccagacctatcctgccgctcccgtg
catctgcctggccttgaccccaagcgcaagtatcgcattagcccgctcgacccaagcctg
gacctcgaaggtctgaccaatggtcaaagcaccctcggttggtggaacgaagaaggcgta
gtcctgaccggcgaagccctgcagcgctacggcatccgtcccccgtccctccaccctcag
caggcagtactgttcaaggccgtggcgttaagctga

DBGET integrated database retrieval system