KEGG   Bifidobacterium breve 689b: B689b_0524Help
Entry
B689b_0524        CDS       T03119                                 

Definition
O-Glycosyl hydrolases family 30, Glucosylceramidase
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
bbrv  Bifidobacterium breve 689b
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bbrv00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    B689b_0524
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    B689b_0524
Enzymes [BR:bbrv01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     B689b_0524
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
663570..665117
Genome map
AA seq 515 aa AA seqDB search
MAQPVNSYRYEYWTRTSGDLKDRRTPIDVPHIVSTPGDAVKIVVDPTQEYQMWEGAGAAI
TDSSASLFMNSMTSEQRHAILTEMFDPEQGGFSSVRMSIGACDFSSQKYYTYDDLPDGVA
ADAALEHFSIGTGEPGAPDATRDMKNVVPVLQEIVSINPAVKIMASPWSAPAWMKTSNRI
DGSGRLRLGEYVGNGYRYQDTIDYVYAQYFVKFIEAYAKLGIHITSVTMQNEPSNGCPWP
ITVWTPEELTQWGSEYLRPALDRTFSDVEIYFGDDSLRFWQRPASEYMTPAQAQCFAGAA
FHTYSGLPTWVHNGTRQFPQWKSAMTERRCMLDETVDEASHVMFGEIGNWLVRNGVGLIN
LWNIALDEQGFPSYAGTSGRRGVITIDSSTGKVKRNLEYFMLRNYGQDVPVGSRRIGSSN
YTPDGRNGGLGSVAFESKRGDLSVIVYNPGGTDVEAAITINGEGARWQKVVVPAYGTVTF
HKSDREMNVSTVPEDDEFKITYTPHPADDHDETLF
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atggctcagcccgtcaactcttatcgatatgagtattggacccgtaccagcggtgatctg
aaggaccgccgcaccccgatcgatgttccgcacatcgtttcgacaccaggggacgccgtc
aagatcgtcgttgaccccacacaggaataccagatgtgggaaggcgccggagcggctatt
acggattcctcggcatcgctgttcatgaactcaatgactagcgaacagcgtcacgcgatt
ctcacggagatgttcgaccccgagcaaggtggcttctcctccgtgcgtatgtcgataggc
gcatgcgacttctccagccagaaatactacacctatgacgatttgccggacggtgttgcc
gctgacgccgctttggaacacttctccataggaacaggggagccaggggctccggatgct
acccgagacatgaagaatgttgtgccggtgcttcaggaaatcgtgtcgattaatccggca
gtcaaaatcatggcttctccctggagcgctccggcttggatgaagacatccaatcgtatc
gacggttcggggcgtttgcgtcttggggaatacgttggcaatggctatcgctaccaagac
accattgactatgtatatgcccagtatttcgtcaaattcatcgaggcatacgccaagctt
gggattcacatcacttctgtgacgatgcaaaacgagccgtccaacggctgcccctggccg
atcaccgtctggactccggaggaactgacccaatggggaagcgaatacctgcgtccggcg
cttgacaggactttctccgatgttgaaatctatttcggagacgactcattgcgcttctgg
cagcgccctgccagcgaatacatgacgccggcgcaggcgcagtgctttgcaggagcggcc
ttccatacatattccggcttgccgacatgggtgcataatggaacacgccaatttcctcag
tggaagagtgcaatgacggaacgtcgatgcatgcttgacgagactgtcgacgaggccagc
catgtgatgttcggcgaaatcggcaattggctggtgcgtaatggcgtgggactgatcaac
ctgtggaacatagcacttgacgagcagggattcccgagctatgcaggcacatccgggcgt
cgcggagtcatcaccatcgactcgagcaccggtaaggtcaaacgaaatctcgagtacttc
atgctacgcaattatggacaggatgtgccggtcggctcacggcgtatcggctcgtccaat
tacactccggatggccgcaatggcggtctggggtcggtggcattcgagagcaaacgcggc
gacctgagcgtgattgtgtataatcctggcggtacggatgtcgaagcggccatcaccatt
aacggtgagggggcacgatggcagaaagtcgtcgtgccggcatacggaacggttactttc
cataagtctgatcgagagatgaatgtctcgactgttcctgaggatgatgaattcaagatc
acctatacccctcatccggctgatgaccacgatgagacattgttctaa

DBGET integrated database retrieval system