KEGG   Borrelia bissettii: BbiDN127_0054Help
Entry
BbiDN127_0054     CDS       T01593                                 

Gene name
tpiA
Definition
triose-phosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bbs  Borrelia bissettii
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:bbs00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BbiDN127_0054 (tpiA)
   01230 Biosynthesis of amino acids
    BbiDN127_0054 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BbiDN127_0054 (tpiA)
   00051 Fructose and mannose metabolism
    BbiDN127_0054 (tpiA)
   00562 Inositol phosphate metabolism
    BbiDN127_0054 (tpiA)
Enzymes [BR:bbs01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     BbiDN127_0054 (tpiA)
Exosome [BR:bbs04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BbiDN127_0054 (tpiA)
  Exosomal proteins of bladder cancer cells
   BbiDN127_0054 (tpiA)
  Exosomal proteins of melanoma cells
   BbiDN127_0054 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(50473..51234)
Genome map
AA seq 253 aa AA seqDB search
MRKTFLAGNWKMHYTSSEASVVAKKIAAEVKTLKDDVVIMITPPFTALSKVSECIKGSNI
LLGAQNMSYMESGARTSEISPSMLLEFGVEYVILGHSECRLYLAETDEIINKKILAGLKH
PFKYLILCVGETLDERDSGKTLEVVLNQVKKGLNCVSESDIKRIILAYEPVWAIGTGKTA
TKEEAEEVHKAIRLEIMRLYSKSASDDIIIQYGGSVNSSNVKELMNEPNIDGALIGGASL
KAESFLSIINNVL
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaacatttttagcgggaaattggaaaatgcattatacaagttcagaagcttct
gttgttgcaaaaaaaattgcagctgaggttaagaccttaaaagatgatgttgtaataatg
ataactcctccatttacggctttatctaaggtttcagaatgtattaagggtagcaatatt
cttcttggcgctcagaatatgtcttatatggaaagcggagcaaggacaagcgaaatttct
ccttcaatgcttttggaatttggagtagaatatgttatacttggtcattctgaatgtagg
ttgtatttagcagaaacagatgaaataataaataaaaagattcttgcgggacttaagcat
ccttttaaatacttaattctttgtgttggggaaactcttgatgaaagagactctggaaaa
actttagaggttgttttaaatcaggttaaaaaagggttaaattgtgtttctgaatcagat
attaaaaggataattttagcttatgaacctgtttgggcaattggaacgggtaaaaccgca
actaaagaggaagcagaagaggttcataaggcaattaggcttgagattatgagactttat
tcaaagtcagcttcagacgatattataattcagtatggaggttctgttaattcaagcaat
gtaaaagagcttatgaatgagcctaatattgatggtgcgttaataggtggagcatcttta
aaggcggaatcttttttatctataattaataatgttctttag

DBGET integrated database retrieval system