KEGG   Borrelia bissettii: BbiDN127_0206Help
Entry
BbiDN127_0206     CDS       T01593                                 

Gene name
gtaB
Definition
UTP--glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bbs  Borrelia bissettii
Pathway
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:bbs00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:bbs00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:bbs00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
208234..209070
Genome map
AA seq 278 aa AA seqDB search
MKGIILAAGYGTRFLPITKTIPKEMLPILNKPAIDYIIQEFIDSGIKDILLISSRRKKVL
EDYFDREIELENIFLKENKKDELDKIKTKKINISFIRQKEMLGTGNALLYAKPWINREPV
IVAYPDDLCIGNPPLSLQLINLYEKTGKSIISIIENPENINKYGVIELYKDEIHVKNIVE
KPKIGSEPSNKASIGRFLYNYEFFEHLEEGFKLHQKGEYYHIYALKKLMDQKKVLYKNIE
GKRIDIGTLEGYLEAIINFAQKDKNLMEIIKKGINEND
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggcattattctggcggctgggtatggtacaagatttttaccaataacaaaaaca
attccaaaagaaatgctaccaattttaaacaaaccagccatagattatattattcaagaa
tttatcgattcaggaataaaagacattttattaataagttcaagacgaaaaaaagttctt
gaagattattttgacagagaaattgaacttgaaaatatttttttaaaagaaaataaaaaa
gatgaattagataagattaaaaccaaaaaaattaacataagcttcataaggcaaaaagaa
atgctaggcacaggaaatgcactgctttatgcaaaaccctggataaatagagagcctgtg
attgtagcttaccctgatgatctttgcattggaaatccaccattaagcttacaattgatc
aatctttatgaaaaaactggaaagagcataatatctatcattgaaaatccagaaaatata
aataaatatggtgtaatagaactctacaaagacgaaattcatgtaaaaaacattgttgaa
aaaccaaaaattggaagtgaacccagtaataaagcatctattgggagatttttgtacaat
tatgagttttttgaacatttagaagaaggattcaaactacaccaaaaaggtgaatactac
cacatttatgctttaaaaaagctaatggatcaaaaaaaagtattatataaaaatattgaa
ggaaaaagaattgacataggaactcttgaaggttatttagaggcaataataaattttgcc
caaaaagataaaaatttaatggaaattataaaaaaaggaataaatgaaaacgattaa

DBGET integrated database retrieval system