KEGG   Borrelia bissettii: BbiDN127_0206Help
Entry
BbiDN127_0206     CDS       T01593                                 

Gene name
gtaB
Definition
UTP--glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bbs  Borrelia bissettii
Pathway
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bbs00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BbiDN127_0206 (gtaB)
   00052 Galactose metabolism
    BbiDN127_0206 (gtaB)
   00500 Starch and sucrose metabolism
    BbiDN127_0206 (gtaB)
   00520 Amino sugar and nucleotide sugar metabolism
    BbiDN127_0206 (gtaB)
Enzymes [BR:bbs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     BbiDN127_0206 (gtaB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
208234..209070
Genome map
AA seq 278 aa AA seqDB search
MKGIILAAGYGTRFLPITKTIPKEMLPILNKPAIDYIIQEFIDSGIKDILLISSRRKKVL
EDYFDREIELENIFLKENKKDELDKIKTKKINISFIRQKEMLGTGNALLYAKPWINREPV
IVAYPDDLCIGNPPLSLQLINLYEKTGKSIISIIENPENINKYGVIELYKDEIHVKNIVE
KPKIGSEPSNKASIGRFLYNYEFFEHLEEGFKLHQKGEYYHIYALKKLMDQKKVLYKNIE
GKRIDIGTLEGYLEAIINFAQKDKNLMEIIKKGINEND
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggcattattctggcggctgggtatggtacaagatttttaccaataacaaaaaca
attccaaaagaaatgctaccaattttaaacaaaccagccatagattatattattcaagaa
tttatcgattcaggaataaaagacattttattaataagttcaagacgaaaaaaagttctt
gaagattattttgacagagaaattgaacttgaaaatatttttttaaaagaaaataaaaaa
gatgaattagataagattaaaaccaaaaaaattaacataagcttcataaggcaaaaagaa
atgctaggcacaggaaatgcactgctttatgcaaaaccctggataaatagagagcctgtg
attgtagcttaccctgatgatctttgcattggaaatccaccattaagcttacaattgatc
aatctttatgaaaaaactggaaagagcataatatctatcattgaaaatccagaaaatata
aataaatatggtgtaatagaactctacaaagacgaaattcatgtaaaaaacattgttgaa
aaaccaaaaattggaagtgaacccagtaataaagcatctattgggagatttttgtacaat
tatgagttttttgaacatttagaagaaggattcaaactacaccaaaaaggtgaatactac
cacatttatgctttaaaaaagctaatggatcaaaaaaaagtattatataaaaatattgaa
ggaaaaagaattgacataggaactcttgaaggttatttagaggcaataataaattttgcc
caaaaagataaaaatttaatggaaattataaaaaaaggaataaatgaaaacgattaa

DBGET integrated database retrieval system