KEGG   Borrelia bissettii: BbiDN127_0570Help
Entry
BbiDN127_0570     CDS       T01593                                 

Definition
cheB methylesterase family protein
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
bbs  Borrelia bissettii
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:bbs00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BbiDN127_0570
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    BbiDN127_0570
Enzymes [BR:bbs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     BbiDN127_0570
Two-component system [BR:bbs02022]
 CheA family
  CheA-CheYBV
   BbiDN127_0570
Bacterial motility proteins [BR:bbs02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    BbiDN127_0570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
578002..579159
Genome map
AA seq 385 aa AA seqDB search
MKILVIDIQGLIKQVFVRAFSKDNDVEILNAGFNSLNLINVFLQKFPDLVIIDENTARSN
FGNSLNNVLNKISLPVVFIAQNEMFPNFGCLEQSKEKIRLIINKLNFKLTVDLFRSKYLA
LIKLELKNLGKNKLISSFEVKRIHAPDFSSNSKVELKENSLDDSSIRKSYKVSDVINFAP
KNDPDVIIKYQGLINKHKTGKIIVVGSSTGGTEALRIFLRSFKKDSPPIIIVQHMPGGFT
KSFAKNLNNEFNIDIKEAEDGDILRPGLVIIANGSYHLIVKYSSGNYFVNLLDGPLVSRH
KPSVNVLFRSAAMYAGSNAIGVILTGMGDDGAVCMLEMKKNGAYTIAQDQETSVVFGMPM
EAIKIGAVDKILPLSEIADHVLRRS
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgaagatattagtaattgatattcaaggtcttataaagcaagtttttgttagagctttt
tctaaagataatgatgttgagatattaaatgctggttttaattctttaaatcttattaat
gtatttttacaaaaatttccagatttagttattattgatgagaatacagcaagatctaat
tttggaaattctttaaacaatgttcttaataagatatctcttccggttgtatttattgct
caaaatgaaatgtttccaaattttggatgtcttgagcaaagcaaggaaaagattagatta
ataataaataagcttaattttaagcttacagttgatttatttcgcagtaagtatttagct
ttaataaagctggagttgaaaaatctaggcaaaaataaattaatatcttcttttgaagtt
aaaaggattcatgcacccgatttttctagtaattctaaagtagaattgaaagaaaatagt
ttagatgattcaagtataaggaaaagctataaagtttctgatgttattaattttgctccc
aaaaatgatccggatgttattattaaatatcaaggtcttatcaataagcacaaaactggc
aaaattattgttgtgggttcttcaacaggcggcacagaggctttaagaatttttttaagg
tcttttaaaaaagattctcctccaattattattgttcagcatatgccgggaggatttaca
aaatcttttgcaaaaaacttaaacaatgagtttaatattgatattaaagaggctgaagat
ggagacattcttcgtccgggtcttgtaataattgctaatgggagttatcatttgattgta
aaatatagtagcggaaattattttgtaaacttattagatggacctcttgttagtagacac
aagccttctgtgaatgtactttttaggtctgctgcaatgtatgcaggctctaatgctatt
ggagttatccttacaggcatgggagatgatggtgctgtttgtatgcttgaaatgaaaaaa
aatggtgcttatactattgcccaagatcaagaaacctctgttgtttttggcatgccaatg
gaagctataaaaataggagccgtagacaaaatccttcctttaagcgaaatagctgatcat
gttttgaggagatcttag

DBGET integrated database retrieval system